KEGG   Arabidopsis thaliana (thale cress): AT1G74320Help
Entry
AT1G74320         CDS       T00041                                 

Definition
choline kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT1G74320
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     AT1G74320
    2.7.1.82  ethanolamine kinase
     AT1G74320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 350 aa AA seqDB search
MTMGGTEKNVENKQYRLPREVKEALQAIASEWEDVIDSKALQVIPLKGAMTNEVFQIKWP
TREKGPSRKVLVRIYGEGVEIFFDREDEIRTFEFMSKHGHGPLLLGRFGNGRIEEFLHAR
TLSACDLRDPEISGRIATRMKEFHGLEMPGAKKALLWDRLRNWLTACKRLASPEEAKSFR
LDVMEMEINMLEKSLFDNDENIGFCHNDLQYGNIMMDEETKAITIIDYEYSCYNPVAYDI
ANHFCEMAADYHTETPHIMDYSKYPGVEERQRFLKTYMSYSDEKPSDTMVKKLLEDVEKY
TLASHLIWGLWGIISEHVNEIDFDYMEYARQRFEQYWLTKPRLLAASEHK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgggtggtactgaaaagaatgtagagaataaacaatatcgtttgcctcgagaa
gtcaaggaagctttacaagcaatagcatcagagtgggaagatgtgattgattcaaaggct
ctgcaagttattcctttaaaaggtgcaatgacaaatgaggtgtttcagatcaaatggcca
actagggaaaaaggtccttctcgtaaggttttggttaggatttatggtgaaggtgttgag
attttctttgatcgtgaggatgagatcaggacatttgagttcatgtcgaagcatggtcat
ggacctttgttgttaggtcggtttggtaatggtcgtatcgaagagttcctccatgcacgg
accctatctgcttgtgacttgcgtgatcctgaaatatctggtcgaatagcaactaggatg
aaggagtttcatggtcttgaaatgcctggtgcgaaaaaggctttgctttgggacagatta
cgaaattggctcactgcatgcaagagactggcttcaccagaagaagctaagtcctttcgt
ctcgatgttatggagatggaaattaatatgcttgagaaatctctctttgacaatgatgaa
aatattggattttgccacaatgatttacagtatgggaacatcatgatggatgaagagacc
aaagcaataaccatcattgattatgaatattcatgctataatcctgtggcttatgacatt
gccaatcacttctgtgagatggctgccgattaccacactgaaacacctcacatcatggat
tatagtaaataccctggtgtggaggagcgacaaagatttctgaaaacatatatgagttat
tcagatgaaaagcccagcgatactatggtcaaaaaactcctagaagacgttgagaaatat
acacttgctagtcatctaatttggggtttatggggaattatatcggaacatgtgaatgaa
atcgactttgactacatggagtatgcaagacaaaggttcgagcagtattggttaacaaag
ccgaggctccttgcagcttccgaacacaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system