KEGG   Arabidopsis thaliana (thale cress): AT1G74470Help
Entry
AT1G74470         CDS       T00041                                 

Definition
(RefSeq) geranylgeranyl diphosphate reductase
  KO
K10960  
geranylgeranyl reductase [EC:1.3.1.83]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT1G74470
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT1G74470
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.83  geranylgeranyl diphosphate reductase
     AT1G74470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 467 aa AA seqDB search
MATTVTLKSFTGLRQSSTEQTNFVSHVPSSLSLPQRRTSLRVTAARATPKLSNRKLRVAV
IGGGPAGGAAAETLAQGGIETILIERKMDNCKPCGGAIPLCMVGEFNLPLDIIDRRVTKM
KMISPSNIAVDIGRTLKEHEYIGMVRREVLDAYLRERAEKSGATVINGLFLKMDHPENWD
SPYTLHYTEYDGKTGATGTKKTMEVDAVIGADGANSRVAKSIDAGDYDYAIAFQERIRIP
DEKMTYYEDLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKGDIKKFQLATRNRAKD
KILGGKIIRVEAHPIPEHPRPRRLSKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAI
VEGSQNGKKMIDEGDLRKYLEKWDKTYLPTYRVLDVLQKVFYRSNPAREAFVEMCNDEYV
QKMTFDSYLYKRVAPGSPLEDIKLAVNTIGSLVRANALRREIEKLSV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacggttacactcaaatccttcaccggacttcgtcaatcatcaacggagcaa
acaaacttcgtctctcatgtaccgtcatcactttctctccctcaacgacggacctctctc
cgagtaaccgcagccagagccactcccaaactctccaaccgtaaactccgtgtcgccgtc
atcggtggtggaccagcaggcggggcagctgcagagactctagcacaaggaggaatcgag
acgattctcatcgagcgtaagatggacaattgcaagccttgcggtggcgcgattcctctc
tgtatggtcggagaattcaacttgccgttggatattattgatcggagagtgacgaagatg
aagatgatttcgccgtcgaacattgctgttgatattggtcgtacgcttaaggagcatgag
tatataggtatggtgagaagagaagttcttgatgcttatctgagagagagagctgagaag
agtggagccactgtgattaacggtctcttccttaagatggatcatccggagaattgggac
tcgccgtacactttgcattacactgagtacgatggtaaaactggagctacagggacgaag
aaaacaatggaggttgatgctgtcattggagctgatggagctaactctagggttgctaaa
tctattgatgctggtgattacgactacgcaattgcatttcaggagaggattaggattcct
gatgagaaaatgacttactatgaggatttagctgagatgtatgttggagatgatgtgtcg
ccggatttctatggttgggtgttccctaagtgcgaccatgtagctgttggaacaggtact
gtgactcacaaaggtgacatcaagaagttccagctcgcgaccagaaacagagctaaggac
aagattcttggagggaagatcatccgtgtggaggctcatccgattcctgaacatccgaga
ccacgtaggctctcgaaacgtgtggctcttgtaggtgatgctgcagggtatgtgactaaa
tgctctggtgaagggatctactttgctgctaagagtggaagaatgtgtgctgaagccatt
gtcgaaggttcacagaatggtaagaagatgattgacgaaggggacttgaggaagtacttg
gagaaatgggataagacatacttgcctacctacagggtacttgatgtgttgcagaaagtg
ttttacagatcaaatccggctagagaagcgtttgtggagatgtgtaatgatgagtatgtt
cagaagatgacattcgatagctatctgtacaagcgggttgcgccgggtagtcctttggag
gatatcaagttggctgtgaacaccattggaagtttggttagggctaatgctctaaggaga
gagattgagaagcttagtgtttaa

DBGET integrated database retrieval system