KEGG   Arabidopsis thaliana (thale cress): AT1G74880Help
Entry
AT1G74880         CDS       T00041                                 

Gene name
NDH-O
Definition
(RefSeq) NAD(P)H:plastoquinone dehydrogenase complex subunit O
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 158 aa AA seqDB search
MAFSATVSQLSSLSTISSSLPISSRRLPHRSLPQFTVKAEAEKEKQSTQGKSDGEASPAA
TKTPKTLPKKPVYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLR
VFETGEYALVGWVGIPTAPAWLPTDMLIKCEKLVYERM
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctttctctgcgactgtgtctcagctttcttctctttcaaccatctcctcttcatta
ccaatttcttctagaagactccctcatcgatctcttcctcaattcacagtcaaagcagaa
gcagagaaagagaaacagagcacacagggcaagtctgatggggaagcatcaccagctgca
accaaaacccctaaaaccctccccaagaaaccggtttactcgatgaagaagggccaaatc
gttcgtgtggaaaaagagaagtacctcaacagcatcaattacttatcagttggacatcct
cctttctacaaaggacttgattacatatacgaagatcgcggcgaggtcttggaccttcgt
gtctttgagacaggagagtatgcacttgttggatgggttggtatccccaccgcaccagct
tggctcccaacagatatgctcatcaagtgtgagaaacttgtttacgagcgaatgtag

DBGET integrated database retrieval system