KEGG   Arabidopsis thaliana (thale cress): AT1G74900Help
Entry
AT1G74900         CDS       T00041                                 

Gene name
OTP43
Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR_1 PPR PPR_3 PPR_long MRP-S27 TPR_15 RPM2
Motif
Other DBs
NCBI-GeneID: 843829
NCBI-ProteinID: NP_177628
MIPS: AT1G74900.1
TAIR: AT1G74900
Araport: AT1G74900
UniProt: Q9S7R4
Position
1
AA seq 453 aa AA seqDB search
MKRLFSKSLCTSAAGANLKPPPADSAAIAKLILSSPNTTHQDDQFLLSTKTTPWTPNLVN
SVLKRLWNHGPKALQFFHFLDNHHREYVHDASSFDLAIDIAARLHLHPTVWSLIHRMRSL
RIGPSPKTFAIVAERYASAGKPDKAVKLFLNMHEHGCFQDLASFNTILDVLCKSKRVEKA
YELFRALRGRFSVDTVTYNVILNGWCLIKRTPKALEVLKEMVERGINPNLTTYNTMLKGF
FRAGQIRHAWEFFLEMKKRDCEIDVVTYTTVVHGFGVAGEIKRARNVFDEMIREGVLPSV
ATYNAMIQVLCKKDNVENAVVMFEEMVRRGYEPNVTTYNVLIRGLFHAGEFSRGEELMQR
MENEGCEPNFQTYNMMIRYYSECSEVEKALGLFEKMGSGDCLPNLDTYNILISGMFVRKR
SEDMVVAGNQAFAKEILRLQSKSGSRLLRKFRL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtctttttagcaaatcgctatgtacttcggccgccggagccaatctcaaacca
ccgccggcagattccgccgccatagctaagcttatcctctcttctccgaacacaactcac
caagacgatcaatttctactctccaccaaaacaaccccatggaccccaaatctcgtgaac
tctgttctcaagcgactctggaaccacggccctaaagctctccaattcttccacttcctc
gacaatcaccaccgcgaatatgtccacgacgcttcctccttcgatctcgcaatcgacatt
gccgcccgtcttcacctccaccccaccgtctggtcactcattcaccgtatgcgctctctc
cgcatcggtccttctcccaaaaccttcgcaatcgtcgccgagaggtacgcatccgctggg
aagcccgataaagcggttaagctgtttctgaatatgcacgaacatggttgttttcaagat
ttagcttctttcaatacgattctcgatgtgttgtgtaaatctaaacgcgtagagaaagct
tatgagttgtttagagctcttaggggaagatttagtgttgatacagttacttacaatgtg
attcttaacggttggtgtttgattaaaaggacgcctaaggctttagaagttttgaaagag
atggttgagagagggataaaccctaatttgactacttataacacaatgctcaaaggtttt
ttcagagctgggcagattagacatgcttgggaattcttcttggagatgaagaaacgggat
tgtgaaatagatgttgtcacttatactactgtggttcacgggtttggtgttgcgggggag
ataaagcgggcgaggaatgttttcgatgagatgattagagaaggtgtgcttccttctgtt
gcgacgtacaatgctatgattcaagttttgtgtaagaaagataatgtggagaatgcggtt
gtgatgtttgaggaaatggtgaggagaggttatgagccgaatgtgacgacttataatgtg
ttgataagagggttgtttcacgctggagagtttagtcgtggagaggagttgatgcagaga
atggagaatgaaggctgtgaaccaaacttccagacatataacatgatgatccgttattat
tcggaatgcagcgaggtcgagaaagcgttgggtttgtttgagaaaatggggagtggtgat
tgcttgccaaatctagatacttacaacatactgataagtggaatgtttgtgagaaaaaga
tcagaagatatggtggtcgctgggaatcaagcttttgcaaaggagatcttgagattgcag
agtaaatctggtagccggcttctccggaagttcaggctatga

DBGET integrated database retrieval system