KEGG   Arabidopsis thaliana (thale cress): AT1G74960Help
Entry
AT1G74960         CDS       T00041                                 

Gene name
FAB1
Definition
3-oxoacyl-[acyl-carrier-protein] synthase II
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ath01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ath00061]
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:ath00780]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 541 aa AA seqDB search
MVGASSSYASPLCTWFVAACMSVSHGGGDSRQAVALQSGGRSRRRRQLSKCSVASGSASI
QALVTSCLDFGPCTHYNNNNALSSLFGSNSVSLNRNQRRLNRAASSGGAMAVMEMEKEAA
VNKKPPTEQRRVVVTGMGVETSLGHDPHTFYENLLQGNSGISQIENFDCSEFPTRIAGEI
KSFSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGGVTDEVMAEFDKTKCGVLIGSAMGG
MKVFYDAIEALRISYKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCIL
NSANHIIKGEADVMLCGGSDAVIIPIGLGGFVACRALSQRNNDPTKASRPWDTNRDGFVM
GEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGAGVILCIERALASAG
ISKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSMIGHLLGAAGAVEAVA
TVQAIRTGWVHPNINLENPDSGVDTKLLVGPKKERLDIKAALSNSFGFGGHNSSIIFAPY
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtgcgtcttcctcttacgcatctccgttatgtacctggtttgttgctgcttgc
atgtccgtctctcacggtggaggagatagccgtcaggctgttgctcttcaatctggtggg
cggagtcggcgaaggaggcagcttagcaaatgctctgtcgcttctggatccgctagcatt
caggctctcgtcacttcttgtttggattttggtccttgtactcactacaacaacaacaat
gcattgtcttctctctttggatcgaatagtgtttctttgaatcgaaaccagaggagattg
aatcgtgctgctagctccggtggagccatggcagtgatggagatggaaaaggaagctgcg
gttaacaagaaaccacctacggagcagcgtcgagttgtagtgacaggcatgggagttgaa
acatcattgggtcatgacccacataccttctatgagaatttgctacaaggcaacagtggt
attagccagattgaaaattttgattgttctgaatttcctacgcgaattgcgggagagatc
aaaagcttctcgactgaaggatgggttgctccaaaactttctaaaaggatggacaaattc
atgctctatcttctcacagctggtaagaaagctttggctgatggtggggttactgatgaa
gtaatggcagagtttgacaaaaccaaatgtggagttttgattggctcggcaatgggagga
atgaaggtcttttacgatgctattgaagctctgagaatctcttacaagaagatgaatcct
ttttgtgtaccttttgcgacaacaaacatgggttctgctatgcttgccatggatctggga
tggatggggccaaactattctatttcaactgcttgtgccacaagcaacttttgcattctg
aattcagcaaaccacattattaaaggtgaagctgatgtaatgctctgtggtggctcagat
gcagttattattccaatagggttgggaggttttgttgcatgccgggctctttcacaaagg
aataatgatcccacaaaagcttcacgtccttgggataccaatcgagatggtttcgtgatg
ggagagggagctggagttctacttttggaagaactcgagcatgctaagaaaagaggtgca
actatctacgcagagttcctcggtgggagtttcacatgtgatgcctatcacatgaccgag
cctcaccctgatggggctggtgttattctctgtattgagagagcgttagctagtgctggg
atttccaaggaacaaataaattacataaatgcacatgcaacctcaacgcatgctggagat
attaaggaataccaagcccttgctcactgttttggccaaaatcctgagcttaaggtaaat
tccacaaaatctatgattggacacttgctgggagctgctggggccgtggaggctgttgca
actgtgcaggcgatacggaccggatgggttcatccaaatatcaacctcgagaatccagac
agtggagtggatacaaagctgctggtgggtcctaagaaggagagactggacattaaagca
gccttgtcaaattcattcgggtttggtggtcataactccagcatcatttttgctccttac
aagtga

DBGET integrated database retrieval system