KEGG   Arabidopsis thaliana (thale cress): AT1G75220Help
Entry
AT1G75220         CDS       T00041                                 

Gene name
ERDL6
Definition
(RefSeq) Major facilitator superfamily protein
  KO
K08145  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 8
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transporters [BR:ath02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    AT1G75220 (ERDL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 487 aa AA seqDB search
MSFRDDNEEARNDLRRPFIHTGSWYRMGSRQSSMMGSSQVIRDSSISVLACVLIVALGPI
QFGFTCGYSSPTQAAITKDLGLTVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMI
AAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQNMRGGLGSVNQ
LSVTIGIMLAYLLGLFVPWRILAVLGILPCTLLIPGLFFIPESPRWLAKMGMTDEFETSL
QVLRGFETDITVEVNEIKRSVASSTKRNTVRFVDLKRRRYYFPLMVGIGLLVLQQLGGIN
GVLFYSSTIFESAGVTSSNAATFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISL
VIVAAAFYLKEFVSPDSDMYSWLSILSVVGVVAMVVFFSLGMGPIPWLIMSEILPVNIKG
LAGSIATLANWFFSWLITMTANLLLAWSSGGTFTLYGLVCAFTVVFVTLWVPETKGKTLE
ELQSLFR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcagggatgataatgaggaggctaggaatgatttgcgtcggccgtttattcac
accggaagctggtaccggatgggttcgagacaatcgagtatgatgggttcctctcaagtt
attcgagacagctctatctctgttcttgcatgtgttttgatcgttgctcttggccctatt
caattcggattcacttgtggttattcatctccaactcaagctgcaatcaccaaggatctc
ggtttaacagtatctgagtactctgtgtttggttctctttccaatgtgggtgctatggtt
ggtgcaattgccagtggtcagattgcagaatacattggacgaaaagggtctcttatgatt
gctgcaattcccaatatcattggatggctttgcatatcatttgcaaaagatacttctttt
ctttacatgggaagacttttagaaggctttggcgttgggatcatctcttacactgtacct
gtatatatcgctgagatagctccacaaaatatgagaggaggattgggttcggttaaccag
ctttctgtgacaattggaataatgttggcgtatttacttggcctctttgttccatggaga
attcttgcagttctggggatattgccgtgtacattattgataccaggtctctttttcatc
cccgaatcccctcgctggctggcaaaaatgggtatgacagatgaatttgaaacttcatta
caagttcttcgaggatttgagactgatattaccgttgaagttaatgaaatcaagagatct
gtggcatcatctacaaagcgaaatacagttcggtttgtagatctcaaacgcaggagatac
tatttcccacttatggttggtatagggttgcttgtacttcaacaacttggtggaattaat
ggtgtcctattctattccagtacaatatttgaatctgcaggagttacatcgagtaacgca
gcaacatttggggtcggggctattcaggtagtagcgactgcaatatccacttggttggtg
gacaaagcaggtcgtcggcttctgcttactatctcttcggttgggatgacgattagcctt
gtaattgttgcagctgctttctatcttaaggaatttgtgtctcctgattcagacatgtac
agttggctgagcatattgtcagtagttggagttgtggcaatggttgtctttttctcattg
ggaatgggaccaataccgtggctcattatgtctgagatccttcctgtgaacataaagggt
ttagctggaagtattgcaactctagccaattggttcttttcttggttgatcaccatgaca
gcaaatttgctgttagcctggagcagtggaggaactttcactctgtatggattggtttgt
gcattcacagtggtgttcgtgactctatgggttcctgagaccaaaggcaaaactcttgaa
gaacttcaatccttgttcagatga

DBGET integrated database retrieval system