KEGG   Arabidopsis thaliana (thale cress): AT1G75410Help
Entry
AT1G75410         CDS       T00041                                 

Gene name
BLH3
Definition
(RefSeq) BEL1-like homeodomain 3
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: POX Homeobox_KN Homeobox Homez
Motif
Other DBs
NCBI-GeneID: 843877
NCBI-ProteinID: NP_001077827
MIPS: AT1G75410.1
TAIR: AT1G75410
Araport: AT1G75410
UniProt: Q9FWS9
Position
1
AA seq 524 aa AA seqDB search
MAVYYPNSVGMQSLYQESIYLNEQQQQQQQASSSSAASFSEIVSGDVRNNEMVFIPPTSD
VAVNGNVTVSSNDLSFHGGGLSLSLGNQIQSAVSVSPFQYHYQNLSNQLSYNNLNPSTMS
DENGKSLSVHQHHSDQILPSSVYNNNGNNGVGFYNNYRYETSGFVSSVLRSRYLKPTQQL
LDEVVSVRKDLKLGNKKMKNDKGQDFHNGSSDNITEDDKSQSQELSPSERQELQSKKSKL
LTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQI
QVIRGKLGERETSDEQGERIPRLRYLDQRLRQQRALHQQLGMVRPAWRPQRGLPENSVSI
LRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMIEEMYKEEFGES
AELLSNSNQDTKKMQETSQLKHEDSSSSQQQNQGNNNNNIPYTSDAEQNLVFADPKPDRA
TTGDYDSLMNYHGFGIDDYNRYVGLGNQQDGRYSNPHQLHDFVV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtattaccctaatagtgtcggcatgcaatctctttaccaagaatccatttac
ctcaacgaacaacaacaacaacaacaacaagcttcttcttcctctgctgcatctttctcc
gagattgtttccggtgatgttcgaaacaacgagatggtatttatcccaccaacaagcgac
gtagccgtcaacggaaacgtaacggtgtcaagtaacgatctaagctttcacggtggagga
ctttctttaagtcttggtaatcagatccagtcagctgtctctgtttctccgtttcagtat
cattaccagaatctttcgaaccaattgagttacaataatcttaatccttctactatgtct
gatgagaatgggaagagcttgagtgttcatcagcatcactctgatcaaattttaccttcc
tctgtttacaacaacaatggtaataatggtgttggattctacaacaattaccgttacgag
acatcagggtttgtgagtagtgtactgagatctcgttaccttaaaccaacacaacaattg
cttgatgaagttgttagtgtaaggaaagatttgaaattggggaataagaagatgaagaat
gataaaggtcaagactttcacaatgggtctagtgataacattacagaagatgataaatct
caatcgcaggagttgtctccttcagaacgtcaggagctacagagcaagaagagcaagctt
ttaacaatggtggatgaggtagataaaaggtataaccaataccatcatcaaatggaagct
ttagcatcgtctttcgagatggtaacaggtcttggagcagctaagccttacacatccgta
gctctgaatagaatctctcgccatttccgctgtttacgcgacgcgataaaagaacagatt
caggtgatcagagggaagcttggggagagagagacttctgatgaacaaggagagaggata
ccgcgtcttaggtacttagatcaacggttgagacaacagagagctttgcatcaacaactt
ggaatggttagaccagcttggagaccacaaagaggcttacctgaaaactctgtctctata
cttcgagcttggctctttgagcatttccttcatccatatcctaaagaatcagagaaaatc
atgctttcaaagcagacaggactatcgaaaaaccaggttgcaaattggtttattaacgcg
agagttcgactatggaaaccaatgattgaagagatgtataaagaagagtttggagaatca
gcagagttactctctaactctaatcaagacaccaaaaaaatgcaggaaacatctcagctc
aaacacgaagactcttcgtcttcgcaacaacagaatcagggaaacaacaacaacaacatc
ccatatacatctgatgcagaacaaaacctagtctttgcagatcctaaaccagaccgtgct
actactggagattacgacagcttgatgaactatcatgggtttggtattgatgattacaat
cgttacgttggccttggaaaccaacaagatggcagatattctaatccccatcaattacac
gactttgttgtctaa

DBGET integrated database retrieval system