KEGG   Arabidopsis thaliana (thale cress): AT1G77010Help
Entry
AT1G77010         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 PPR_1 PPR_3 PPR_long TPR_17
Motif
Other DBs
NCBI-GeneID: 844037
NCBI-ProteinID: NP_177827
MIPS: AT1G77010.1
TAIR: AT1G77010
Araport: AT1G77010
UniProt: O49287 A0A178WE64
Position
1
AA seq 695 aa AA seqDB search
MILKYNSSYRFYLSSSFLQAMEVDCRRYYVRLLQSCSSRNRETLWRQTNGLLLKKGFLSS
IVIVANHLLQMYSRSGKMGIARNLFDEMPDRNYFSWNTMIEGYMNSGEKGTSLRFFDMMP
ERDGYSWNVVVSGFAKAGELSVARRLFNAMPEKDVVTLNSLLHGYILNGYAEEALRLFKE
LNFSADAITLTTVLKACAELEALKCGKQIHAQILIGGVECDSKMNSSLVNVYAKCGDLRM
ASYMLEQIREPDDHSLSALISGYANCGRVNESRGLFDRKSNRCVILWNSMISGYIANNMK
MEALVLFNEMRNETREDSRTLAAVINACIGLGFLETGKQMHCHACKFGLIDDIVVASTLL
DMYSKCGSPMEACKLFSEVESYDTILLNSMIKVYFSCGRIDDAKRVFERIENKSLISWNS
MTNGFSQNGCTVETLEYFHQMHKLDLPTDEVSLSSVISACASISSLELGEQVFARATIVG
LDSDQVVSSSLIDLYCKCGFVEHGRRVFDTMVKSDEVPWNSMISGYATNGQGFEAIDLFK
KMSVAGIRPTQITFMVVLTACNYCGLVEEGRKLFESMKVDHGFVPDKEHFSCMVDLLARA
GYVEEAINLVEEMPFDVDGSMWSSILRGCVANGYKAMGKKAAEKIIELEPENSVAYVQLS
AIFATSGDWESSALVRKLMRENNVTKNPGSSWTDC
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgattttgaagtacaatagtagttacaggttttatctttcaagtagttttctccaagct
atggaagtagattgtcggcgttattacgtacgtcttcttcaatcatgcagcagcagaaat
cgcgaaactttatggagacaaaccaatggattgctcttgaagaagggttttcttagttca
attgtcattgttgctaaccatctcctccaaatgtactcccggtctggtaaaatgggaatt
gcgcggaacttgttcgacgaaatgcctgatagaaactatttctcgtggaacactatgatt
gaagggtacatgaattctggggaaaagggaacgtctttgaggttttttgatatgatgcca
gaaagagatgggtactcttggaacgtggttgtttccgggtttgctaaagctggtgagcta
agtgtcgctaggaggttattcaatgccatgccggaaaaagatgttgtgacgttgaactct
ctgcttcatggatatattttaaacggttatgcagaggaagctctgaggttgtttaaagaa
ttgaattttagcgctgatgcgatcacattgacgacagttcttaaagcttgtgctgagtta
gaagctttgaaatgtgggaagcagatacatgctcagattctgatcggtggtgttgaatgt
gactcgaaaatgaatagttctttagttaatgtgtatgcaaagtgtggtgatttgagaatg
gcaagctatatgctggagcagattagggaacctgatgaccattctctatctgccttaatt
tcaggttatgcaaattgtgggagagtgaatgagtctagaggacttttcgataggaaaagt
aacagatgtgtaattctatggaactctatgatttcaggctatattgctaacaatatgaaa
atggaggcattggttcttttcaatgagatgaggaatgaaacccgggaagattctcgtacg
ctggcagcggttataaatgcttgcatcggtttgggcttcctagagactggtaaacaaatg
cattgtcatgcttgtaaatttgggttaattgatgacattgttgtagctagcactttgctt
gacatgtactccaagtgtggaagcccaatggaagcttgcaaacttttcagtgaggtcgaa
tcctatgacactatcttacttaacagtatgatcaaggtatatttcagctgcggaagaatc
gatgatgcaaaacgggtatttgagagaattgaaaataagagcttgatttcttggaactca
atgactaacggattcagtcaaaatggttgtactgttgaaactttagagtatttccatcag
atgcataagctggatttgcctacagatgaggttagcctctctagtgtcattagtgcgtgt
gcaagtatatcttctctcgaactcggtgagcaagtttttgcgagggcaactattgttggt
cttgactctgatcaagtagtatcatcttctctcattgatctctactgcaagtgtggattc
gttgagcatggcaggagagtattcgatacaatggttaaatcagatgaagtaccatggaac
tcaatgatatcaggttatgctacgaatggtcaaggatttgaagcgattgacttgttcaag
aaaatgagtgttgctggtataagacctactcagatcacttttatggttgttctaacagca
tgcaattactgtggtttagtcgaagagggacgaaaattgtttgagtcaatgaaggttgat
catggttttgttccagataaagagcatttttcatgtatggttgatcttttggctcgtgct
ggttatgtggaagaagctataaatcttgtagaagagatgcctttcgatgtggatggaagc
atgtggtcatctattctaagaggatgtgtagcaaatggatataaagccatgggaaagaaa
gctgctgagaagattatagagcttgaacctgagaactcagttgcttatgtgcagttgtcc
gctatattcgcaacctcgggagattgggaaagctcggcgcttgtaagaaaactgatgagg
gagaacaatgtgacaaagaatccaggttctagttggactgattgttga

DBGET integrated database retrieval system