KEGG   Arabidopsis thaliana (thale cress): AT1G77120Help
Entry
AT1G77120         CDS       T00041                                 

Gene name
ADH1
Definition
alcohol dehydrogenase 1
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ath01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ath00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ath00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ath00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 379 aa AA seqDB search
MSTTGQIIRCKAAVAWEAGKPLVIEEVEVAPPQKHEVRIKILFTSLCHTDVYFWEAKGQT
PLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPIFTGECGECRHCHSEESNMCDLLRINT
ERGGMIHDGESRFSINGKPIYHFLGTSTFSEYTVVHSGQVAKINPDAPLDKVCIVSCGLS
TGLGATLNVAKPKKGQSVAIFGLGAVGLGAAEGARIAGASRIIGVDFNSKRFDQAKEFGV
TECVNPKDHDKPIQQVIAEMTDGGVDRSVECTGSVQAMIQAFECVHDGWGVAVLVGVPSK
DDAFKTHPMNFLNERTLKGTFFGNYKPKTDIPGVVEKYMNKELELEKFITHTVPFSEINK
AFDYMLKGESIRCIITMGA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaccggacagattattcgatgcaaagctgctgtggcatgggaagccggaaag
ccactggtgatcgaggaagtggaggttgctccaccgcagaaacacgaagttcgtatcaag
attctcttcacttctctctgtcacaccgatgtttacttctgggaagctaagggacaaaca
ccgttgtttccacgtatcttcggccatgaagctggagggattgttgagagtgttggagaa
ggagtgactgatcttcagccaggagatcatgtgttgccgatctttaccggagaatgtggg
gagtgtcgtcattgccactcggaggaatcaaacatgtgtgatcttctcaggatcaacacc
gagcgaggagggatgattcacgatggtgaatcaagattctccattaatggcaaaccaatt
taccatttccttgggacttccacgttcagtgagtacacagtggttcactctggtcaggtt
gctaagatcaatccggatgctcctcttgacaaggtctgtattgtcagttgtggtttgtct
actgggttaggagcaactttgaatgtggctaaacccaagaaaggtcaaagtgttgccatt
tttggtcttggtgctgttggtttaggcgctgcagaaggtgctagaatcgctggtgcttct
aggatcatcggtgttgattttaactctaaaagattcgaccaagctaaggaattcggtgtg
accgagtgtgtgaacccgaaagaccatgacaagccaattcaacaggtgatcgctgagatg
acggatggtggggtggacaggagtgtggaatgcaccggaagcgttcaggccatgattcaa
gcatttgaatgtgtccacgatggctggggtgttgcagtgctggtgggtgtgccaagcaaa
gacgatgccttcaagactcatccgatgaatttcttgaatgagaggactcttaagggtact
ttcttcgggaactacaaacccaaaactgacattcccggggttgtggaaaagtacatgaac
aaggagctggagcttgagaaattcatcactcacacagtgccattctcggaaatcaacaag
gcctttgattacatgctgaagggagagagtattcgttgcatcatcaccatgggtgcttga

DBGET integrated database retrieval system