KEGG   Arabidopsis thaliana (thale cress): AT1G77120Help
Entry
AT1G77120         CDS       T00041                                 

Gene name
ADH1
Definition
alcohol dehydrogenase 1
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AT1G77120 (ADH1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G77120 (ADH1)
  Lipid metabolism
   00071 Fatty acid degradation
    AT1G77120 (ADH1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AT1G77120 (ADH1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AT1G77120 (ADH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 379 aa AA seqDB search
MSTTGQIIRCKAAVAWEAGKPLVIEEVEVAPPQKHEVRIKILFTSLCHTDVYFWEAKGQT
PLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPIFTGECGECRHCHSEESNMCDLLRINT
ERGGMIHDGESRFSINGKPIYHFLGTSTFSEYTVVHSGQVAKINPDAPLDKVCIVSCGLS
TGLGATLNVAKPKKGQSVAIFGLGAVGLGAAEGARIAGASRIIGVDFNSKRFDQAKEFGV
TECVNPKDHDKPIQQVIAEMTDGGVDRSVECTGSVQAMIQAFECVHDGWGVAVLVGVPSK
DDAFKTHPMNFLNERTLKGTFFGNYKPKTDIPGVVEKYMNKELELEKFITHTVPFSEINK
AFDYMLKGESIRCIITMGA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaccggacagattattcgatgcaaagctgctgtggcatgggaagccggaaag
ccactggtgatcgaggaagtggaggttgctccaccgcagaaacacgaagttcgtatcaag
attctcttcacttctctctgtcacaccgatgtttacttctgggaagctaagggacaaaca
ccgttgtttccacgtatcttcggccatgaagctggagggattgttgagagtgttggagaa
ggagtgactgatcttcagccaggagatcatgtgttgccgatctttaccggagaatgtggg
gagtgtcgtcattgccactcggaggaatcaaacatgtgtgatcttctcaggatcaacacc
gagcgaggagggatgattcacgatggtgaatcaagattctccattaatggcaaaccaatt
taccatttccttgggacttccacgttcagtgagtacacagtggttcactctggtcaggtt
gctaagatcaatccggatgctcctcttgacaaggtctgtattgtcagttgtggtttgtct
actgggttaggagcaactttgaatgtggctaaacccaagaaaggtcaaagtgttgccatt
tttggtcttggtgctgttggtttaggcgctgcagaaggtgctagaatcgctggtgcttct
aggatcatcggtgttgattttaactctaaaagattcgaccaagctaaggaattcggtgtg
accgagtgtgtgaacccgaaagaccatgacaagccaattcaacaggtgatcgctgagatg
acggatggtggggtggacaggagtgtggaatgcaccggaagcgttcaggccatgattcaa
gcatttgaatgtgtccacgatggctggggtgttgcagtgctggtgggtgtgccaagcaaa
gacgatgccttcaagactcatccgatgaatttcttgaatgagaggactcttaagggtact
ttcttcgggaactacaaacccaaaactgacattcccggggttgtggaaaagtacatgaac
aaggagctggagcttgagaaattcatcactcacacagtgccattctcggaaatcaacaag
gcctttgattacatgctgaagggagagagtattcgttgcatcatcaccatgggtgcttga

DBGET integrated database retrieval system