KEGG   Arabidopsis thaliana (thale cress): AT1G78050Help
Entry
AT1G78050         CDS       T00041                                 

Gene name
PGM
Definition
(RefSeq) phosphoglycerate/bisphosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00260  Glycine, serine and threonine metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ath_M00002  Glycolysis, core module involving three-carbon compounds
ath_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G78050 (PGM)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G78050 (PGM)
Enzymes [BR:ath01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AT1G78050 (PGM)
Membrane trafficking [BR:ath04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AT1G78050 (PGM)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AT1G78050 (PGM)
  Exosomal proteins of melanoma cells
   AT1G78050 (PGM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 844140
NCBI-ProteinID: NP_177928
MIPS: AT1G78050.1
TAIR: AT1G78050
Araport: AT1G78050
UniProt: F4I8M8 A0A178WMJ7
Position
1
AA seq 332 aa AA seqDB search
MATSTTMSHQAIGSVVSQRPFKASQFLKEPLNNVPMKFRQKRFKIEATASQISVVDNTFL
SPSPSKNKPHESKKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTQKGVGEAIEAGKKI
SNIPVDLIFTSSLIRAQMTAMLAMTQHRRKKVPIILHNESVKAKTWSHVFSEETRKQSIP
VIAAWQLNERMYGELQGLNKKETAERYGTQQVHEWRRSYEIPPPKGESLEMCAERAVAYF
EDNIKPELASGNNVMIAAHGNSLRSIIMYLDDLTSQEVTTLDLSTGVPLLYIFKEGKFMK
RGSPVGSTEAGVYAYTKRLAQYREKLDAAATI
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctacttctacgactatgtctcatcaagcgattgggtctgttgtctctcaaagacca
ttcaaagcttctcagtttctaaaggagcctttgaataatgtaccaatgaaattcagacaa
aaaagattcaagattgaagcaactgcttctcagatatctgtcgttgacaacactttcttg
tctccgtctccttccaagaacaaaccacatgaatctaagaagaaatcaaatgaagcagct
ttgatattgattaggcatggagaatcgttatggaatgagaagaatttgttcacgggttgt
gttgatgtgccattgactcagaaaggtgttggagaagctattgaagctgggaagaagatt
agtaacattcctgtagatttgattttcacttcttctttaatccgtgctcagatgactgca
atgcttgccatgactcagcatcgtcgcaagaaggttccaatcatcttgcacaacgagagt
gtaaaggcgaaaacttggagtcatgttttcagcgaagaaactagaaaacaatctatcccg
gttatagcggcttggcaactgaatgagagaatgtatggagagttgcagggtttgaacaag
aaagaaacagcggaaagatacgggacacaacaagttcacgaatggcgcaggagttacgaa
attcctcctccgaaaggcgagagcttggagatgtgtgctgagagagcagtggcttatttt
gaagacaatatcaaaccagagcttgcatctggaaacaatgtaatgattgctgctcacggg
aactcattgagatctatcattatgtatcttgacgatttaacttctcaggaggttacaact
ctagacctgtccacaggtgtaccattgctctacatcttcaaagaaggcaagttcatgaaa
cgaggaagccccgtcggttctactgaagctggtgtctatgcttatacaaagagattggca
caatacagagagaagcttgatgcggcggcgaccatttaa

DBGET integrated database retrieval system