KEGG   Arabidopsis thaliana (thale cress): AT1G78120Help
Entry
AT1G78120         CDS       T00041                                 

Gene name
TPR12
Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Position
1
AA seq 480 aa AA seqDB search
MAKSKKISTGQIFGCESLLGCIFQSWSPRRRKPSLPEKDHRAKDNLSSKSSTTVTNPKIL
PRKSTDTSSQPKKSDSQKPQQKPKPDENHPRKSSESARKSSDSARKSISSGSSRTESKRF
SLNGVMGNIIVKPQPAVKTDVTQTKSRWEGKPVNHRLDPETLKKMGNEEYCRGRFGQALV
FYERAISADPKTPTYWSNKSAALISLGRLLEASDACEEALRLNPTYERAHQRLASLQLRL
GEVEKALCHYNEAGKYTETKHIEQVEDVVKCLRRCDEARRSKEWNVALKETLFAISYGAD
SSPRVYALQTEALLHLQRHEEAYSVYQKGTKRFDIDSFIKIFGLSLTSYLLMVGAQVYIA
VGRFEDAVTASRQAARLDPSSEEVNAVARKARAVASARLSGNLLFNASKFEGASVVYTEG
LENDPYNALLLCNRAASRFKLDLFEKAIEDCTLALSLQPSYRKARRRRADSYAKVFKSLI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatcgaagaaaatttctacaggtcaaatatttggttgtgagagtctccttggg
tgcattttccagagctggagccctcgccgtcgaaaaccctctttaccggaaaaggatcat
cgggcaaaagataacttgtcttccaagtcatcaacaaccgttacaaaccctaaaatcctc
ccaagaaaatccaccgatacttcttctcaaccaaagaaatctgactcccagaaaccccaa
caaaagccaaaaccagatgagaatcacccgcgaaaatcatcggaatccgccagaaaatca
tctgattccgcaagaaaatcgatttcgtcaggctcatcaagaacagagagcaagagattc
tcacttaacggcgttatgggaaacatcatcgtgaaaccacagccagccgttaaaactgac
gtgacacagacgaaaagtcggtgggagggtaaaccggtaaatcacagactcgatccagag
actctgaagaaaatgggaaacgaagagtattgtcgtgggaggtttggacaagctctcgtg
ttttacgagagagccatttcagctgaccccaaaacgccgacgtattggtctaacaaatcc
gccgctttgatcagtctcggtcgtcttcttgaagcttctgatgcttgtgaagaagcttta
agactaaacccaacttacgagagagctcatcagagactagcttccctccaactcagattg
ggtgaggttgagaaagctttgtgtcactataatgaagctggaaaatatacagagacaaaa
catattgaacaagttgaagatgttgttaaatgcttaaggaggtgtgacgaagctcgaaga
tcaaaggaatggaatgttgcattgaaagagactctttttgcgatatcatatggagcagat
tcttctcctcgggtctatgcactccaaaccgaggctttattgcatcttcagcgacacgag
gaagcatacagcgtgtatcagaaaggaacaaaacgcttcgacatcgatagtttcataaag
atttttggtctttccctcacttcttacctcttgatggtcggagctcaggtctacatagca
gtaggaaggtttgaagatgcagtaacggcgtcaaggcaagcggctcgacttgatccaagc
agcgaagaagtaaacgcggtggctagaaaagcgagagcggttgcttctgcaagactgagt
ggaaatttgcttttcaacgcatcaaaatttgaaggggctagcgtggtttacacggaagga
cttgagaacgatccatataatgctctcttgctctgtaacagagctgcttcaagattcaag
cttgatctgttcgagaaagctattgaagattgcacattggctctcagtctccagccatcg
taccggaaggcgaggcggcgcagggcagattcttatgccaaggtattcaaaagcttaatt
taa

DBGET integrated database retrieval system