KEGG   Arabidopsis thaliana (thale cress): AT1G78670Help
Entry
AT1G78670         CDS       T00041                                 

Gene name
GGH3
Definition
(RefSeq) gamma-glutamyl hydrolase 3
  KO
K01307  
gamma-glutamyl hydrolase [EC:3.4.19.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AT1G78670 (GGH3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.9  gamma-glutamyl hydrolase
     AT1G78670 (GGH3)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   AT1G78670 (GGH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 352 aa AA seqDB search
MWRFCFFLSLLFFDVSAVKSAESIFLPSQIGVEDSRVFESLSLSPVCSAADPNLNYKPVI
GILTHPGEGRWDARLHSLKNYAYATNISYIAASYVKLAETGGARVIPLIYNEPEEILFQK
LELVNGVIFTGGWAKTGLYYDVVEKIFNKVMEKNDAGEHFPVYAMCLGFEILSMIISQNR
DILERFNSVNYASSLQFFKNVNIEATVFQRFPPELLKKLSADCLVMQNHYFGISPDNFQG
NPYLSSFFNIVTTSADKDSKTFVSTIRSKRYPVTAFQWHPEKNAFEWGSSEIPHSEDAIQ
VTQHAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKGSGDDEVYIFT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggagattctgcttcttcttatcgttactattctttgatgttagcgcggtgaaatct
gcagaatcgattttcctcccaagtcaaatcggagttgaagattcccgcgtctttgaatct
cttagtcttagtcctgtatgctccgcggctgatccaaacctcaactacaagccggtcatc
gggattctgacccaccctggcgaaggtcgatgggacgctcgtcttcactctctgaaaaac
tacgcctacgcgacgaacatatcgtacatcgcagcttcgtatgtgaagttagctgagact
ggtggagctcgtgtgattcctcttatctacaacgagcctgaagaaatcttgtttcagaag
ctagaattggtaaatggtgtgatattcacaggtggttgggctaaaacagggttatattac
gatgttgtggagaaaatcttcaataaagttatggagaaaaatgatgctggagaacatttt
ccggtgtacgccatgtgtcttggattcgagattttgtcaatgatcataagtcagaacaga
gacattcttgagaggtttaactcagtaaactatgcatcaagtctccagttttttaaaaac
gttaatatcgaagcaaccgtgttccaaagatttcctccagagctgttgaaaaagctcagt
gcagactgtttggttatgcagaaccactattttggtatctcaccagacaactttcaaggc
aatccttatctgtctagtttcttcaatatcgtcacaaccagcgccgataaagacagcaag
acttttgtttcaactattcgatcaaaacgataccctgtgaccgccttccaatggcatcca
gagaaaaatgcattcgaatggggatcatctgaaatcccacactctgaggacgcaattcag
gtgactcaacatgctgcaaattatctagtcagtgaagccagaaagtcaatgaacagacca
tcttctgagaaagtgctgagcaatctcatctacaactacaagcctacgtactccggatac
aaagggagcggtgacgacgaggtttatattttcacgtaa

DBGET integrated database retrieval system