KEGG   Arabidopsis thaliana (thale cress): AT1G80460Help
Entry
AT1G80460         CDS       T00041                                 

Gene name
NHO1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT1G80460 (NHO1)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT1G80460 (NHO1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AT1G80460 (NHO1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G80460 (NHO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 482 aa AA seqDB search
MAKENGFIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVKV
CIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRR
LEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWN
MTGGINGGLHVTDVTNASRTMLMNLKTLSWDQDTLKTLGIPAEILPKIVSNSEVIGEICK
GWPIPGIKIAGCLGDQHAAMLGQACRKGEAKSTYGTGAFILLNTGEVPIKSGHGLLTTLA
YKLGPQAQTNYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFN
GLFAPWWREDARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGK
GEFLLRVDAVGFWKEADIFESGEKAKNSKVFRPAMEEGIRKKKVASWCKAVERTFDLADL
SI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaatggatttataggatcaatcgatcaaggaaccaccagcaccagattc
atcatttacgaccacgatgctcgtcctgttgcttctcatcaagtcgagttcactcagttc
tatcccgaagctggatgggtggaacacgatccaatggagatactggaaagtgtgaaagtg
tgcattgcaaaggctctcgacaaagccactgccgatggacacaacgtcgacggtggcttg
aaggccattgggcttacagatcagagagagactactgttgtttggagcaaatccactggc
cttcctctccacaaggctattgtctggatggatgctcgtaccagctccatctgcaggaga
ctagagaaagaactctcgggaggaagatcccattttgtggagtcttgcggcttgccaata
agcacatacttctctgccatgaagctgctttggctcatggagaatgtggatgatgtcaaa
gacgctatcaagaaaggggatgccatctttggcactatcgacacatggttgatctggaac
atgactggcggtatcaatggcggccttcatgtcactgatgtcaccaatgcttcacggaca
atgctcatgaacctcaaaaccttgagctgggaccaggacactttgaagacacttggcata
ccggctgaaatcttgcccaagattgtcagcaattcagaagtgattggagagatctgcaaa
ggctggcctattcccggtatcaagattgctggatgtcttggtgatcagcatgctgcgatg
ttggggcaagcttgcagaaaaggcgaggcgaagagtacttatggcacaggtgctttcatt
cttctcaacaccggagaagtgccaatcaaatcaggtcatggtcttctgaccacgttggcc
tacaagctcggtcctcaagcacagacaaactatgcattggagggttcgattgccatagca
ggagctgctgttcagtggcttagagacagccttgggataatcaaaagcgcctctgagatc
gaagatttggcagcaatggtagattctacaggaggagtgtactttgtgccagcgttcaac
ggcttgtttgctccttggtggagagaagacgcacgtggtgtgtgcattggaatcacgagg
ttcaccaacaagtctcacattgctcgggctgtgctggagagcatgtgtttccaggtgaaa
gacgtccttgactccatgaacaaagatgcaggtgaaaagggttcccttaataacgggaaa
ggggagttcttgctcagagttgatgctgtgggattctggaaggaagcagacatattcgag
tcgggagagaaggcgaagaactccaaagttttcagacccgctatggaagaaggaatcagg
aagaagaaagtggcgtcttggtgcaaagcggtggaaagaacatttgatctcgctgacctc
tctatctaa

DBGET integrated database retrieval system