KEGG   Arabidopsis thaliana (thale cress): AT1G80670Help
Entry
AT1G80670         CDS       T00041                                 

Definition
Rae1-like protein
Orthology
K14298  
mRNA export factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT1G80670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 349 aa AA seqDB search
MATFGAPATANSNPNKSYEVTPSPADSISSLSFSPRADILVATSWDNQVRCWEISRSGAS
LASAPKASISHDQPVLCSAWKDDGTTVFSGGCDKQAKMWPLLSGGQPVTVAMHEGPIAAM
AWIPGMNLLATGSWDKTLKYWDTRQQNPVHTQQLPDKCYTLSVKHPLMVVGTADRNLIVF
NLQNPQTEFKRIQSPLKYQTRCVTAFPDQQGFLVGSIEGRVGVHHLDDSQQSKNFTFKCH
RDGNDIYSVNSLNFHPVHGTFATAGSDGAFNFWDKDSKQRLKAMSRCNQPIPCSSFNHDG
SIYAYAACYDWSKGAENHNPATAKSSIFLHLPQESEVKAKPRVGATGRK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttttggtgcgcctgctaccgccaacagtaaccctaacaaatcctacgaggtt
actccatcaccggcagattctatttcgagcttaagttttagtccaagagctgatatactt
gtggccacttcatgggacaatcaggtgaggtgttgggaaatatcccgtagtggagcctct
ctagccagtgctcctaaagcatcaatatcacatgatcagccggttttatgttctgcttgg
aaagatgatggaaccacagtctttagcggtggatgtgataagcaagcaaaaatgtggccc
ttgttgtctggtggtcaacctgtaactgttgctatgcatgagggtcctatcgcagctatg
gcttggatcccgggaatgaatctccttgcaactggaagttgggataaaactttgaaatat
tgggacacaagacagcaaaatcctgtacatacccaacagcttccagacaaatgttataca
ttgtctgtgaaacatcctctgatggttgtcgggactgccgatagaaatctgatagtcttc
aacttgcaaaatcctcagactgagtttaagagaatccaatccccactgaagtaccagacg
aggtgtgttactgccttccctgatcagcaaggttttttggttggttcaattgaggggcgg
gttggtgttcatcatctggatgattctcaacagagcaaaaacttcacattcaaatgccac
agagatggaaatgatatatattctgtcaactctctgaatttccacccggtacatggcact
tttgcaactgctgggtcagatggtgctttcaatttctgggacaaagatagtaaacaaaga
ctcaaggccatgtcgaggtgcaatcagccaattccatgcagctcgttcaaccacgatgga
tcgatatatgcatatgcggcttgctatgactggagcaaaggtgcagaaaatcacaacccg
gcgactgcaaaaagcagcattttcttgcacctgccacaggaaagcgaggttaaggccaag
ccaagagttggagcaaccggcagaaaatga

DBGET integrated database retrieval system