KEGG   Arabidopsis thaliana (thale cress): AT2G01760Help
Entry
AT2G01760         CDS       T00041                                 

Gene name
RR14
Definition
(RefSeq) two-component response regulator ARR14
  KO
K14491  
two-component response regulator ARR-B family
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT2G01760 (RR14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 382 aa AA seqDB search
MPINDQFPSGLRILVVDDDTSCLFILEKMLLRLMYQVTICSQADVALTILRERKDSFDLV
LSDVHMPGMNGYNLLQQVGLLEMDLPVIMMSVDGRTTTVMTGINHGACDYLIKPIRPEEL
KNIWQHVVRRKCVMKKELRSSQALEDNKNSGSLETVVVSVSECSEESLMKCRNKKKKKKR
SVDRDDNEDDLLLDPGNSKKSRVVWSIELHQQFVNAVNKLGIDKAVPKRILELMNVPGLS
RENVASHLQKFRLYLKRLSGEASQSNDSESTKRYENIQALVSSGQLHPQTLAALFGQPID
NHHSASFGVWIPNDNLGRSQNEHFSVDVSSASNRPVSVAVHGLSSSANFRQRGDVNNNRI
RQGYGSNVNEESWILERSSRQR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgatcagtttcctagtgggttaagaatactcgttgtagacgatgatact
tcatgcttgttcattctcgagaaaatgcttctccgtctcatgtaccaagttacaatttgc
tcacaagctgatgttgcgttaaccattctaagagaaagaaaagacagttttgatttggtg
ctaagtgatgttcatatgcctggtatgaatggttacaatcttcttcaacaagttggtctt
cttgaaatggatcttcctgtcattatgatgtctgttgatggaagaacaactacagtcatg
actggaatcaaccatggagcttgtgattatctaatcaaacctattcgtcctgaagagctt
aagaacatttggcaacatgttgttagaaggaaatgtgtgatgaagaaagagcttcgaagt
tctcaagctttagaggataacaagaacagtggtagcctcgagactgttgttgtttcggtt
agtgaatgctcagaggaaagtttgatgaaatgtaggaataagaagaagaagaagaagaga
agtgttgatagagatgataatgaagatgatcttcttcttgatcctggaaactcgaagaag
tcacgcgttgtttggtctattgaattgcatcaacaattcgttaatgccgtaaacaaactt
ggaattgacaaagctgtaccaaagcggattctcgagttgatgaatgttcctggtttaagc
agagaaaacgtggctagtcatttacagaagttccgattgtatttgaagagattaagcggt
gaagcttcgcagagtaatgactctgagtctaccaaaagatatgaaaacattcaagctctg
gtttcctcaggacaattacatccacagacattagctgcattgtttggtcaaccaatagac
aatcatcactctgctagttttggagtttggattcctaatgacaatcttggtagatctcaa
aatgaacacttctcggttgatgtatcatccgcttctaaccgtcctgtttctgtggcggtt
catggtctatcttcctcagcaaatttcagacagagaggtgacgttaacaacaacagaatc
agacaagggtatggatcaaatgtcaatgaagaatcttggatcttggaaagatcttcaaga
caaagatag

DBGET integrated database retrieval system