KEGG   Arabidopsis thaliana (thale cress): AT2G02750Help
Entry
AT2G02750         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long ATP13 MRP-S27
Motif
Other DBs
NCBI-GeneID: 814804
NCBI-ProteinID: NP_178378
MIPS: AT2G02750.1
TAIR: AT2G02750
Araport: AT2G02750
UniProt: Q1PFA6
Position
2
AA seq 613 aa AA seqDB search
MINLTRQRYRVSNLVTGGTSLDVILSHSPNKFTFPPLLKSCAKLGDVVQGRILHAQVVKT
GFFVDVFTATALVSMYMKVKQVTDALKVLDEMPERGIASVNAAVSGLLENGFCRDAFRMF
GDARVSGSGMNSVTVASVLGGCGDIEGGMQLHCLAMKSGFEMEVYVGTSLVSMYSRCGEW
VLAARMFEKVPHKSVVTYNAFISGLMENGVMNLVPSVFNLMRKFSSEEPNDVTFVNAITA
CASLLNLQYGRQLHGLVMKKEFQFETMVGTALIDMYSKCRCWKSAYIVFTELKDTRNLIS
WNSVISGMMINGQHETAVELFEKLDSEGLKPDSATWNSLISGFSQLGKVIEAFKFFERML
SVVMVPSLKCLTSLLSACSDIWTLKNGKEIHGHVIKAAAERDIFVLTSLIDMYMKCGLSS
WARRIFDRFEPKPKDPVFWNVMISGYGKHGECESAIEIFELLREEKVEPSLATFTAVLSA
CSHCGNVEKGSQIFRLMQEEYGYKPSTEHIGCMIDLLGRSGRLREAKEVIDQMSEPSSSV
YSSLLGSCRQHLDPVLGEEAAMKLAELEPENPAPFVILSSIYAALERWEDVESIRQVIDQ
KQLVKLPGLSLSG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgataaacctaacgagacagagataccgagtctcgaatctcgtgaccggtggaacttcg
ctggatgtgattttgtctcactctcctaacaagttcacattcccgcctcttcttaaatca
tgcgcgaagcttggagatgttgtacaaggtcggattctgcatgcccaagtcgtcaaaact
gggtttttcgttgatgtgttcacggcaacggctttggtgagtatgtatatgaaggtgaag
caggtgacggatgctcttaaggtgctcgatgaaatgcctgagaggggtattgcgagtgtt
aatgcagcggtttctgggcttttggagaatgggttttgtagagatgcgtttaggatgttt
ggggatgctagggtttctgggtctgggatgaattcggttaccgttgctagtgttttgggt
ggttgtggggatattgaaggagggatgcaattgcattgtttggcgatgaaatcaggtttt
gagatggaagtttacgttggaacctctcttgtttcaatgtattcgagatgtggagagtgg
gttttggctgcgagaatgttcgaaaaggttcctcataagagtgttgttacctacaatgct
tttatctctggattgatggagaatggagttatgaatttggttcctagtgttttcaatctc
atgaggaagttttcaagtgaagaaccaaatgatgttacttttgttaatgcaataactgct
tgcgctagtcttttgaatctccagtatggtaggcaacttcatggtcttgtcatgaaaaaa
gagtttcagtttgagacaatggttggtactgctctcattgatatgtattcgaaatgtcgg
tgttggaaatcagcttacattgttttcaccgagctgaaagataccaggaacttgatatct
tggaactctgttatctctggaatgatgattaatggacagcatgagacagcagttgagttg
tttgaaaagttggattccgagggacttaagcctgattcagcgacgtggaattcactgatc
agtggcttttcacaattagggaaagtaattgaagctttcaagttctttgagagaatgcta
tcagtagttatggttcctagtttgaaatgtctcactagccttttatctgcttgttcagat
atttggactttgaagaacggcaaagagatccatgggcatgtcattaaagctgcagcggaa
agggatatatttgttttaacgtctctcattgacatgtacatgaaatgtgggctctcctcg
tgggcacgccggatctttgatcgatttgaaccgaaacccaaggatcccgtgttctggaac
gttatgatatctggatatggtaaacatggagagtgtgagtctgcaattgaaatattcgaa
ctattacgagaggagaaagtagaaccgagtttagcaacctttactgctgttctatctgcg
tgtagtcactgtggcaatgtcgagaagggttctcaaatatttaggttgatgcaggaagaa
tatggatataaacctagtacagagcacataggttgtatgattgatcttttgggtcggtct
gggagattaagagaggccaaggaggtaatagatcaaatgtcagaaccatcgtcttcggtt
tactcttccttgctcggttcatgtaggcaacacctagatccagttcttggagaggaagcg
gcaatgaagctagcagagttagagccagagaatccagctccatttgtgatcttgtccagt
atatatgctgcattagaaagatgggaagatgtggaaagtatcaggcaggtaatagatcag
aagcaactggtgaaacttccaggtcttagtttgtctggttaa

DBGET integrated database retrieval system