KEGG   Arabidopsis thaliana (thale cress): AT2G02980Help
Entry
AT2G02980         CDS       T00041                                 

Gene name
OTP85
Definition
(RefSeq) RNA editing factor OTP85
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 603 aa AA seqDB search
MAISSASLISSFSHAETFTKHSKIDTVNTQNPILLISKCNSLRELMQIQAYAIKSHIEDV
SFVAKLINFCTESPTESSMSYARHLFEAMSEPDIVIFNSMARGYSRFTNPLEVFSLFVEI
LEDGILPDNYTFPSLLKACAVAKALEEGRQLHCLSMKLGLDDNVYVCPTLINMYTECEDV
DSARCVFDRIVEPCVVCYNAMITGYARRNRPNEALSLFREMQGKYLKPNEITLLSVLSSC
ALLGSLDLGKWIHKYAKKHSFCKYVKVNTALIDMFAKCGSLDDAVSIFEKMRYKDTQAWS
AMIVAYANHGKAEKSMLMFERMRSENVQPDEITFLGLLNACSHTGRVEEGRKYFSQMVSK
FGIVPSIKHYGSMVDLLSRAGNLEDAYEFIDKLPISPTPMLWRILLAACSSHNNLDLAEK
VSERIFELDDSHGGDYVILSNLYARNKKWEYVDSLRKVMKDRKAVKVPGCSSIEVNNVVH
EFFSGDGVKSATTKLHRALDEMVKELKLSGYVPDTSMVVHANMNDQEKEITLRYHSEKLA
ITFGLLNTPPGTTIRVVKNLRVCRDCHNAAKLISLIFGRKVVLRDVQRFHHFEDGKCSCG
DFW
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcgatatcttcagcttcactaatatcatcattctcacacgcagaaacgttcactaag
cattcgaaaatcgacactgtgaatacacaaaacccgattcttctgatttccaaatgcaat
tctctaagagagctgatgcaaattcaagcttacgcgatcaaatctcatattgaagatgtt
tccttcgtcgctaagctgataaatttctgcactgagtctccaacggagtcttcaatgtca
tatgcacgccacttgttcgaggcaatgtctgaaccagatattgtcatttttaattctatg
gctcgtgggtattctcgcttcacgaatcctcttgaggtttttagtctcttcgttgagatc
ttagaagatggtattttacctgacaactacactttcccgtctcttctcaaagcttgtgca
gtagcaaaggcgttagaagaaggtagacaattgcattgtttgtcgatgaaactagggctt
gatgataatgtctatgtttgtccaacgcttattaatatgtacactgagtgtgaagatgtg
gattctgctcgttgtgtgtttgatcggattgttgagccgtgtgttgtttgttataatgct
atgatcacgggttatgcgagaagaaacagaccgaacgaggctttatctttgttccgtgaa
atgcaaggtaagtacttgaagccgaatgagattacccttttgagtgttctgtcatcttgt
gctctgttgggatcgttagatttagggaaatggatacataagtatgctaagaaacatagt
ttctgtaagtatgtgaaagtaaacacagctttgatcgatatgtttgcgaaatgtggtagc
ttggatgatgcagtgtctatattcgaaaaaatgaggtataaggatacacaagcttggtca
gcaatgattgtagcttatgcgaatcatgggaaagctgagaaatccatgttgatgtttgag
agaatgaggtctgaaaatgttcagcctgatgagatcacatttctcggtctgttaaacgct
tgcagccacactggtcgagtggaagaagggagaaagtatttctcacagatggttagcaaa
tttgggattgttccgagtattaagcattatggttctatggtagatcttcttagtagagct
ggaaatttagaagatgcatatgaattcattgataagctcccaattagcccaacaccaatg
ctatggaggattcttttagctgcttgtagcagccataacaatttggacctagctgaaaag
gttagcgagaggatctttgagctagatgattcacacggtggcgattacgtgattttatca
aacctatacgcgagaaacaagaaatgggaatatgtagattctttaagaaaggtgatgaaa
gatcgaaaggcggttaaagttcccggttgcagctcgattgaggtaaacaatgtggttcat
gagtttttctcaggggatggtgtgaagtctgcaaccacaaagcttcacagagcattagat
gaaatggtgaaagagctaaagctttcaggttatgttcctgatacatcaatggtagttcac
gccaatatgaatgaccaagagaaggaaattacgcttaggtatcacagcgaaaagcttgcg
ataacgtttggattattgaatactcctccgggaacaacgattcgggttgtgaagaatctt
agggtgtgtagagattgtcacaatgcagcaaagttgatatctcttatatttggtaggaaa
gttgttcttagagatgttcaaaggtttcatcattttgaagatggaaaatgttcttgtggg
gatttttggtga

DBGET integrated database retrieval system