KEGG   Arabidopsis thaliana (thale cress): AT2G03160Help
Entry
AT2G03160         CDS       T00041                                 

Gene name
SK19
Definition
(RefSeq) SKP1-like 19
  KO
K03094  S-phase kinase-associated protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04141  Protein processing in endoplasmic reticulum
Module
ath_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT2G03160 (SK19)
   04120 Ubiquitin mediated proteolysis
    AT2G03160 (SK19)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     AT2G03160 (SK19)
   Cul7 complex
     AT2G03160 (SK19)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     AT2G03160 (SK19)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     AT2G03160 (SK19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ Skp1
Motif
Other DBs
NCBI-GeneID: 814845
NCBI-ProteinID: NP_565295
MIPS: AT2G03160.1
TAIR: AT2G03160
Araport: AT2G03160
UniProt: O81058
Position
2
AA seq 200 aa AA seqDB search
MSSKKIVLTSSDGESFKVEEVVARKLQIVGHIIEDDCATNKIPIPNVTGEILAKVIEYCK
KHVEDDDDVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFM
KDFDIKTIFDIILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEEEEA
IRNENAWTFEQDGKQQVPKP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgaaaaagattgtgttgacaagctccgatggtgaatctttcaaggttgaagaa
gtggtggcaagaaaactgcagatcgtaggacacattatcgaagacgactgtgctacaaac
aaaatccctattccaaacgttaccggagagattctcgccaaggttatcgagtactgcaag
aaacacgttgaagacgatgatgacgtggtggagacgcatgaatcatcgacgaaaggagat
aaaacagttgaggaggcgaagaagaagcctgatgatgtggccgtacctgaatcaactgaa
ggagatgatgaagctgaggataagaaggagaagcttaatgagtgggatgcaaagttcatg
aaggatttcgatattaagacgatcttcgacattattctggctgctaactatctcaacgtc
caaggtctttttgatctctgtagcaagaccattgcagattacataaaagatatgacgcca
gaggaagttcgagaactctttaacatcgagaatgatttcacacctgaagaagaagaagca
attcgcaatgaaaacgcttggacttttgagcaagatggaaaacaacaagttccaaaaccc
tag

DBGET integrated database retrieval system