KEGG   Arabidopsis thaliana (thale cress): AT2G03190Help
Entry
AT2G03190         CDS       T00041                                 

Gene name
SK16
Definition
(RefSeq) SKP1-like 16
  KO
K03094  S-phase kinase-associated protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04141  Protein processing in endoplasmic reticulum
Module
ath_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT2G03190 (SK16)
   04120 Ubiquitin mediated proteolysis
    AT2G03190 (SK16)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     AT2G03190 (SK16)
   Cul7 complex
     AT2G03190 (SK16)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     AT2G03190 (SK16)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     AT2G03190 (SK16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ Skp1
Motif
Other DBs
NCBI-GeneID: 814848
NCBI-ProteinID: NP_565297
MIPS: AT2G03190.1
TAIR: AT2G03190
Araport: AT2G03190
UniProt: O81055
Position
2
AA seq 170 aa AA seqDB search
MSSNKIVLTSSDDESFEVEEAVARKLKVIAHMIDDDCADKAIPLENVTGNILALVIEYCK
KHVLDDVDDSDDSTEATSENVNEEAKNELRTWDAEFMKEFDMETVMKLILAVNYLNVQDL
LGLTCQTVADHMKDMSPEEVRELFNIENDYTPEEEDAIRKENAWAFEDLK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgaacaagattgtgttgactagctcggatgatgaatcgttcgaggttgaggaa
gcggtggctcgtaaattgaaggtcatagcacacatgatcgatgacgactgcgccgataaa
gcaatcccgcttgaaaacgtcaccggaaatatcctcgctttggttatcgagtattgcaag
aaacacgtacttgatgatgttgatgatagtgatgattctactgaagcaacaagcgaaaat
gtaaacgaggaagccaagaacgagctcaggacttgggacgcagagttcatgaaagaattt
gatatggaaacagtcatgaaactcattctcgctgttaattatctcaacgtccaagatctt
cttggtctcacttgccagaccgttgcagatcacatgaaagatatgtcgccagaggaagtt
cgagaactctttaacattgagaatgattacacacctgaagaagaagacgcgattcgtaag
gaaaacgcttgggcttttgaggatctaaagtaa

DBGET integrated database retrieval system