KEGG   Arabidopsis thaliana (thale cress): AT2G03430Help
Entry
AT2G03430         CDS       T00041                                 

Definition
(RefSeq) Ankyrin repeat family protein
  KO
K06694  
26S proteasome non-ATPase regulatory subunit 10
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Proteasome [BR:ath03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     AT2G03430
  Proteasome interacting proteins (PIPs)
   Other PIPs
    AT2G03430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 240 aa AA seqDB search
MEIATDTAKQMRDEELFKAAEWGDSSLFMSLSEEQLSKSLNFRNEDGRSLLHVAASFGHS
QIVKLLSSSDEAKTVINSKDDEGWAPLHSAASIGNAELVEVLLTRGADVNAKNNGGRTAL
HYAASKGRLEIAQLLLTHGAKINITDKVGCTPLHRAASVGKLEVCEFLIEEGAEIDATDK
MGQTALMHSVICDDKQVAFLLIRHGADVDVEDKEGYTVLGRATNEFRPALIDAAKAMLEG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgcaaccgatacagcaaagcagatgagagacgaagagttgttcaaagcagcg
gaatggggagattcatcgttgttcatgtcattatctgaagaacagctctctaaatctctc
aatttcagaaacgaagatggtcgctctctcctccatgtcgctgcttccttcggccattct
caaatagtgaagttgttatcaagttcagatgaagcaaagactgtaatcaatagcaaggat
gatgaaggatgggctcctttgcattccgctgctagcatcggtaatgctgagctcgttgag
gtgcttttgaccagaggtgctgatgtcaatgccaaaaataacggtggtcgcactgctctt
cactatgctgctagcaaaggccggttggagattgctcagcttttattaacacacggtgca
aagattaacatcacagacaaggttggttgcactccgcttcacagggcagcaagcgtggga
aagttagaagtttgtgaatttcttattgaagaaggagcagagatcgatgctacggataaa
atgggtcaaactgcactcatgcattcagttatctgcgatgacaaacaggttgcgttcctg
cttataagacatggtgcagatgtggatgtagaagacaaggaaggctacactgttctaggc
cgagctaccaatgaattccgacctgcacttatcgatgctgctaaggccatgcttgaagga
taa

DBGET integrated database retrieval system