KEGG   Arabidopsis thaliana (thale cress): AT2G15620Help
Entry
AT2G15620         CDS       T00041                                 

Gene name
NIR1
Definition
(RefSeq) nitrite reductase 1
  KO
K00366  
ferredoxin-nitrite reductase [EC:1.7.7.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Nitrogen metabolism
Module
Assimilatory nitrate reduction, nitrate => ammonia
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AT2G15620 (NIR1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.7  With an iron-sulfur protein as acceptor
    1.7.7.1  ferredoxin---nitrite reductase
     AT2G15620 (NIR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 586 aa AA seqDB search
MTSFSLTFTSPLLPSSSTKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFFILK
EKFRKGINPQEKVKIEREPMKLFMENGIEELAKKSMEELDSEKSSKDDIDVRLKWLGLFH
RRKHQYGKFMMRLKLPNGVTTSAQTRYLASVIRKYGEDGCADVTTRQNWQIRGVVLPDVP
EILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLSQFITANSQGNPD
FTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFFSPKRCEEAIPLD
AWVPADDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRTEVEKRMPNGKLER
GSSEDLVNKQWERRDYFGVNPQKQEGLSFVGLHVPVGRLQADDMDELARLADTYGSGELR
LTVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLR
ALKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVG
GRIGSDSHIGEIYKKGVRVTELVPLVAEILIKEFGAVPREREENED
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttctctctcactttcacatctcctctcctcccttcctcctccaccaaaccc
aaaagatccgtccttgtcgccgccgctcagaccacagctccggccgaatccaccgcctct
gttgacgcagatcgtctcgagccaagagttgagttgaaagatggtttttttattctcaag
gagaagtttcgaaaagggatcaatcctcaggagaaggttaagatcgagagagagcccatg
aagttgtttatggagaatggtattgaagagcttgctaagaaatctatggaagagcttgat
agtgaaaagtcttctaaagatgatattgatgttagactcaagtggcttggtctctttcac
cgtagaaagcatcagtatgggaagtttatgatgaggttgaagttaccaaatggtgtgact
acaagtgcacagactcggtatttagcgagtgtgattaggaagtatggtgaagatgggtgt
gctgatgtgactactagacagaattggcagatccgtggtgttgtgttgcctgatgtgcct
gagatcttgaaaggtcttgcttctgttggtttaacgagtcttcaaagtggtatggataac
gtgaggaacccggttgggaatcctatagctgggattgatccggaggagattgttgacacg
aggccttacacgaatctcctttcgcagtttatcaccgctaattcacaaggaaaccccgat
ttcaccaacttgccaagaaagtggaatgtgtgtgtggtggggactcatgatctctatgag
catccacatatcaatgatttggcctacatgcctgctaataaagatggacggtttggattc
aatttgcttgtgggaggattctttagtcccaaaagatgtgaagaagcgattcctcttgat
gcttgggtccctgctgatgacgttcttccactctgcaaagctgttctagaggcttacaga
gatcttggaactcgaggaaaccgacagaagacaagaatgatgtggcttatcgacgaactt
ggtgttgaaggatttagaactgaggtagagaagagaatgccaaatgggaaactcgagaga
ggatcttcagaggatcttgtgaacaaacagtgggagaggagagactatttcggagtcaac
cctcagaaacaagaaggtcttagcttcgtggggcttcacgttccggttggtaggctacaa
gctgatgacatggatgagcttgctcggttagctgatacctacgggtcaggtgagctaaga
ctcacagtagagcaaaacatcatcatcccaaatgtagaaacctcgaaaaccgaagctttg
cttcaagagccgtttctcaagaaccgtttctcccctgaaccatctatcctaatgaaaggc
ttagttgcttgtaccggtagccagttctgcggacaagcgataatcgagactaagctaaga
gctttaaaagtgacagaagaagtagagagacttgtatctgtgccaagaccgataaggatg
cattggacaggatgtcccaacacttgcggacaagtccaagtagcagatatcggattcatg
ggatgcttaacacgaggcgaggaaggaaagccagtcgagggtgctgacgtgtacgtcggg
ggacgaataggaagtgactcgcatatcggagagatctataagaaaggtgttcgtgtcacg
gagttggttccattggtggctgagattctgatcaaagaatttggtgctgtgcctagagaa
agagaagagaatgaagattga

DBGET integrated database retrieval system