KEGG   Arabidopsis thaliana (thale cress): AT2G16370Help
Entry
AT2G16370         CDS       T00041                                 

Gene name
THY-1
Definition
bifunctional dihydrofolate reductase-thymidylate synthase 1
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT2G16370 (THY-1)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AT2G16370 (THY-1)
   00670 One carbon pool by folate
    AT2G16370 (THY-1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AT2G16370 (THY-1)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     AT2G16370 (THY-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 519 aa AA seqDB search
MATTTLNDSVTTTLASEPQRTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDITLTTSD
SSKKNAVVMGRKTWESIPIKYRPLSGRLNVVLTRSGGFDIANTENVVTCSSVDSALDLLA
APPYCLSIERVFVIGGGDILREALNRPSCDAIHLTEIDTSVDCDTFIPAIDTSVYQPWSS
SFPVTENGLRFCFTTFVRVKSSADESSDESNGSQSLQFDGKKFLFLPKMVFDQHEEFLYL
NMVEDIISNGNVKNDRTGTGTLSKFGCQMKFNLRRSFPLLTTKRVFWRGVVEELLWFISG
STNAKVLQEKGIHIWDGNASREYLDGIGLTEREEGDLGPVYGFQWRHFGAKYTDMHADYT
GQGFDQLVDVIDKIKNNPDDRRIIMSAWNPSDLKLMALPPCHMFAQFYVAEGELSCQMYQ
RSADMGLGVPFNIASYSLLTCMLAHVCDLVPGDFIHVLGDAHVYKTHVRPLQEQLLNLPK
PFPVMKINPEKKQIDSFVASDFDLTGYDPHKKIEMKMAV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaactactctcaatgacagtgtcaccactacacttgcttcagagcctcaaagg
acttaccaagttgttgttgctgcaactaaagaaatgggtattggtaaagatgggaaattg
ccatggaatttgccaacagatctcaagttctttaaagacattactttgaccacttcagat
tcctctaagaaaaatgctgttgtgatgggtagaaagacttgggagtctattcccattaag
tataggccgctttcgggtcggcttaacgttgttctaactcgttctggtgggtttgatata
gccaacactgagaatgttgtcacttgtagtagtgtagattctgctcttgatttgttagct
gcgccgccgtattgtttatctattgagagggtttttgttataggaggtggtgacatattg
agggaagcattgaataggcctagttgtgatgctatccatttaactgagattgatacaagt
gttgactgtgatacgtttatacctgcgattgatacttctgtttatcagccttggtcttca
tcgtttccagtaactgaaaatggacttcggttttgcttcacgacttttgtccgtgtaaag
agttctgctgatgaatcttctgatgaaagcaatgggtcacagtctcttcaatttgatggg
aagaagtttttgtttcttcctaagatggtttttgatcagcatgaggagtttctgtatttg
aatatggttgaagatattatctctaatggcaatgtgaagaatgataggaccgggactggt
acattatcaaaatttggttgccagatgaaattcaatttacgcagaagttttccacttctg
acaacaaagcgagttttctggagaggtgttgttgaggaacttctatggttcataagcggt
tcaaccaatgcaaaagtccttcaggaaaaaggtatccatatatgggatgggaatgcgtca
agagagtatctcgatggtatcggcctgacagagagagaggaaggcgaccttggacctgta
tacggatttcaatggcgacactttggtgctaagtacacagatatgcatgctgattatact
ggtcaaggatttgatcaacttgtagatgtaattgacaaaatcaagaacaatcctgatgat
cggcgtattataatgtcagcttggaatccttctgatcttaagctgatggcacttcctcca
tgccatatgtttgcacaattttatgtggcagaaggggaactctcatgtcaaatgtatcag
cgttcagcagatatgggccttggtgtgccgtttaacattgcttcttactctcttcttact
tgcatgctggctcatgtgtgtgatcttgttcctggtgattttatccatgttcttggggat
gctcatgtatacaaaactcacgtgaggcctctgcaagagcaacttctgaatcttccaaaa
ccctttcctgtaatgaagataaacccggagaagaaacaaatcgattcttttgtggcttct
gactttgacctcacaggctatgatcctcacaagaagatagaaatgaaaatggcggtttag

DBGET integrated database retrieval system