KEGG   Arabidopsis thaliana (thale cress): AT2G16400Help
Entry
AT2G16400         CDS       T00041                                 

Gene name
BLH7
Definition
(RefSeq) BEL1-like homeodomain 7
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 482 aa AA seqDB search
MATYYKTGSSEIYSRPEFVPGNAMNYTNSFTETFPRDSTNNVSPSKEIQVLSSLGGVSQM
VEIQDSGSWRDQEDNDRNRFPVMRRLGLSSQIETSRGNNNNEYATQVVSGFTRTIHNSKY
LKAAQELLDETVNVKKALKQFQPEGDKINEVKEKNLQTNTAEIPQAERQELQSKLSKLLS
ILDEVDRNYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILV
IRKSLGGEQDGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSSVLVL
RAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMVEEMYKEEFTDAL
QENDPNQSSENTPEITEIQELQTESSSNNGHVPGVASSSMRQNTVAHGGDRFMMVTDMTR
NGNGGMSLTLGIQNSDARGDVPMSGGIDNYKNTISGTDLQYLNSRNHQHQIGSSQLLHDF
VA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggccacttattacaaaactggctcaagtgagatttattccagaccagaatttgtccct
ggaaacgcaatgaactacacaaattctttcacagagacatttcctagagattcaactaat
aatgtgtcaccttcaaaagagattcaagtgttgtcaagccttggtggagtttcacaaatg
gttgagattcaagattctggttcttggagagatcaagaagacaatgacaggaatcgcttc
ccggtgatgaggcgtcttggcctcagctcgcagattgagacatcgagaggcaataataac
aatgagtatgcaacacaggttgtttcgggatttactcgaaccattcacaactcaaagtat
ctcaaagctgctcaagagcttcttgatgaaactgttaatgttaagaaagctctaaagcag
tttcagccagagggagataagattaatgaagtgaaagagaagaatcttcagacgaatact
gctgaaatccctcaagcagagaggcaagaattgcagagcaagttgtcgaaacttttatcg
atattagacgaggtggatagaaattacaagcagtattaccatcagatgcagatagtcgtg
tcgtctttcgatgtaatagccggatgtggagcagccaaaccatacacagcccttgcgctt
cagaccatctcgaggcatttccgttgcttaagggatgcgatatccggacaaatcttggtg
ataaggaaaagtttaggaggggaacaggatggatcagatgggagaggagtggggataagc
aggttaaggaatgttgatcaacaggtaaggcaacaaagagcgttgcagcggttaggtgtg
atgcaacctcacacttggcggcctcaacgcggtttaccagattcttctgttttggttctc
cgtgcttggctatttgagcatttcctccacccttatccaaaggattcagacaagatcatg
ctcgctagacaaacggggttgagccgaggccaggtatcgaactggttcataaatgcgcgt
gtgcgtctctggaaaccgatggtggaggagatgtacaaggaggaattcacagatgcattg
caggagaatgatcccaaccagtcttctgaaaacacaccagaaatcaccgagattcaagag
ctgcaaactgagtctagttccaacaatgggcatgtacctggtgtggcaagcagtagcatg
agacaaaacacagtggcccatggtggtgaccggttcatgatggtgactgacatgacaaga
aatggtaatggtgggatgtctttaacgttggggattcagaattccgatgctcgtggcgat
gttcctatgtccggtgggatagataactacaagaataccatctcgggaaccgatctacag
tacttaaactctcgcaaccaccagcaccagattggctcttcacaattgttgcatgatttt
gtagcttga

DBGET integrated database retrieval system