KEGG   Arabidopsis thaliana (thale cress): AT2G18050Help
Entry
AT2G18050         CDS       T00041                                 

Gene name
HIS1-3
Definition
(RefSeq) histone H1-3
  KO
K11275  
histone H1/5
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chromosome [BR:ath03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AT2G18050 (HIS1-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 167 aa AA seqDB search
MAEDKILKKTPAAKKPRKPKTTTHPPYFQMIKEALMVLKEKNGSSPYAIAKKIEEKHKSL
LPESFRKTLSLQLKNSVAKGKLVKIRASYKLSDTTKMITRQQDKKNKKNMKQEDKEITKR
TRSSSTRPKKTVSVNKQEKKRKVKKARQPKSIKSSVGKKKAMKASAA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagacaagatcttaaagaagactccggcggcgaagaagccgcgaaaaccgaaa
accaccactcatcctccatactttcagatgataaaagaggctttgatggtcctgaaagag
aagaacggatcaagcccttatgctatagctaagaagatagaggagaaacacaagtcttta
cttccagagagtttccgtaaaacactttctctacagcttaaaaactctgttgctaaaggt
aagctcgtgaagatcagagcctcttacaagctctcagataccaccaagatgataacgagg
cagcaggacaagaagaataagaagaatatgaagcaagaagataaagagatcacaaagagg
actaggtcttcttcgacaaggcctaagaagactgtgtctgtgaacaaacaagaaaagaag
aggaaagtgaagaaggcgagacagcctaagtctatcaaatcttcagttggtaagaagaag
gccatgaaagcttccgctgcttga

DBGET integrated database retrieval system