KEGG   Arabidopsis thaliana (thale cress): AT2G18170Help
Entry
AT2G18170         CDS       T00041                                 

Gene name
MPK7
Definition
mitogen-activated protein kinase 7
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT2G18170 (MPK7)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   AT2G18170 (MPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 368 aa AA seqDB search
MAMLVEPPNGIKQQGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGVVCSSINRETNERVAI
KKIHNVFENRVDALRTLRELKLLRHVRHENVIALKDVMLPANRSSFKDVYLVYELMDTDL
HQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTSQGNEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTECL
NQLKLIINVVGSQQESDIRFIDNPKARRFIKSLPYSRGTHLSNLYPQANPLAIDLLQRML
VFDPTKRISVTDALLHPYMAGLFDPGSNPPAHVPISLDIDENMEEPVIREMMWNEMLYYH
PEAEISNA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgttagttgagccaccaaatgggattaagcaacaagggaaacattactactcc
atgtggcaaacattgttcgaaatcgatacaaagtatgttccgattaaacccattggaaga
ggagcttatggtgtggtttgttcttctatcaatcgtgagactaatgagagagttgctatt
aaaaagattcacaatgtgtttgagaatcgtgttgatgctttgagaacgttgagggaactt
aaacttcttaggcatgtgaggcatgagaatgtgatcgcgcttaaagatgttatgttgcct
gctaatagatccagtttcaaggatgtttatttggtttatgagctaatggatactgatctt
catcagattattaaatcctctcagtctctttctgatgatcactgcaagtacttcttgttt
cagttgcttagagggttgaagtatcttcattctgcaaacatacttcaccgggatttgaag
cccgggaacctcttagttaatgcgaactgcgatctcaagatttgtgatttcgggttggcg
agaacgagccaaggtaatgaacagttcatgactgagtatgtggttacacgttggtacaga
gcacctgagcttcttctttgttgtgataactatggaacctccattgatgtatggtcggtt
ggttgcatattcgcggagattcttggtaggaaaccgatttttccaggaacagaatgcttg
aatcagcttaagctaatcatcaacgttgttggtagccaacaagaatctgatattcggttc
atagacaacccgaaagctcgaaggtttataaagtctcttccgtactcaagaggaactcat
ctctccaatctttatccacaagccaatcctctagctatagatttgttacagaggatgctt
gtgtttgatccaaccaagagaatctctgtaaccgatgcgctcttacacccgtatatggcg
gggttgtttgatcctggatccaatccgcctgcacatgtcccaatctctctggacatagat
gaaaacatggaggaaccagtgataagagagatgatgtggaatgagatgctttattaccac
cctgaagctgaaatctcaaatgcctaa

DBGET integrated database retrieval system