KEGG   Arabidopsis thaliana (thale cress): AT2G18790Help
Entry
AT2G18790         CDS       T00041                                 

Gene name
PHYB
Definition
(RefSeq) phytochrome B
  KO
K12121  
phytochrome B
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT2G18790 (PHYB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 1172 aa AA seqDB search
MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQ
YTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAYLSRIQRGGYIQPFGCM
IAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAMGTDVRSLFTSSSSILLERAFV
AREITLLNPVWIHSKNTGKPFYAILHRIDVGVVIDLEPARTEDPALSIAGAVQSQKLAVR
AISQLQALPGGDIKLLCDTVVESVRDLTGYDRVMVYKFHEDEHGEVVAESKRDDLEPYIG
LHYPATDIPQASRFLFKQNRVRMIVDCNATPVLVVQDDRLTQSMCLVGSTLRAPHGCHSQ
YMANMGSIASLAMAVIINGNEDDGSNVASGRSSMRLWGLVVCHHTSSRCIPFPLRYACEF
LMQAFGLQLNMELQLALQMSEKRVLRTQTLLCDMLLRDSPAGIVTQSPSIMDLVKCDGAA
FLYHGKYYPLGVAPSEVQIKDVVEWLLANHADSTGLSTDSLGDAGYPGAAALGDAVCGMA
VAYITKRDFLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFQAFLEVVKSRSQPWE
TAEMDAIHSLQLILRDSFKESEAAMNSKVVDGVVQPCRDMAGEQGIDELGAVAREMVRLI
ETATVPIFAVDAGGCINGWNAKIAELTGLSVEEAMGKSLVSDLIYKENEATVNKLLSRAL
RGDEEKNVEVKLKTFSPELQGKAVFVVVNACSSKDYLNNIVGVCFVGQDVTSQKIVMDKF
INIQGDYKAIVHSPNPLIPPIFAADENTCCLEWNMAMEKLTGWSRSEVIGKMIVGEVFGS
CCMLKGPDALTKFMIVLHNAIGGQDTDKFPFPFFDRNGKFVQALLTANKRVSLEGKVIGA
FCFLQIPSPELQQALAVQRRQDTECFTKAKELAYICQVIKNPLSGMRFANSLLEATDLNE
DQKQLLETSVSCEKQISRIVGDMDLESIEDGSFVLKREEFFLGSVINAIVSQAMFLLRDR
GLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRYAPSQEWVEIHLSQLSKQMADGF
AAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGLGLSVCRKILKLMNGEVQYIRESER
SYFLIILELPVPRKRPLSTASGSGDMMLMMPY
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggtttccggagtcgggggtagtggcggtggccgtggcggtggccgtggcggagaagaa
gaaccgtcgtcaagtcacactcctaataaccgaagaggaggagaacaagctcaatcgtcg
ggaacgaaatctctcagaccaagaagcaacactgaatcaatgagcaaagcaattcaacag
tacaccgtcgacgcaagactccacgccgttttcgaacaatccggcgaatcagggaaatca
ttcgactactcacaatcactcaaaacgacgacgtacggttcctctgtacctgagcaacag
atcacagcttatctctctcgaatccagcgaggtggttacattcagcctttcggatgtatg
atcgccgtcgatgaatccagtttccggatcatcggttacagtgaaaacgccagagaaatg
ttagggattatgcctcaatctgttcctactcttgagaaacctgagattctagctatggga
actgatgtgagatctttgttcacttcttcgagctcgattctactcgagcgtgctttcgtt
gctcgagagattaccttgttaaatccggtttggatccattccaagaatactggtaaaccg
ttttacgccattcttcataggattgatgttggtgttgttattgatttagagccagctaga
actgaagatcctgcgctttctattgctggtgctgttcaatcgcagaaactcgcggttcgt
gcgatttctcagttacaggctcttcctggtggagatattaagcttttgtgtgacactgtc
gtggaaagtgtgagggacttgactggttatgatcgtgttatggtttataagtttcatgaa
gatgagcatggagaagttgtagctgagagtaaacgagatgatttagagccttatattgga
ctgcattatcctgctactgatattcctcaagcgtcaaggttcttgtttaagcagaaccgt
gtccgaatgatagtagattgcaatgccacacctgttcttgtggtccaggacgataggcta
actcagtctatgtgcttggttggttctactcttagggctcctcatggttgtcactctcag
tatatggctaacatgggatctattgcgtctttagcaatggcggttataatcaatggaaat
gaagatgatgggagcaatgtagctagtggaagaagctcgatgaggctttggggtttggtt
gtttgccatcacacttcttctcgctgcataccgtttccgctaaggtatgcttgtgagttt
ttgatgcaggctttcggtttacagttaaacatggaattgcagttagctttgcaaatgtca
gagaaacgcgttttgagaacgcagacactgttatgtgatatgcttctgcgtgactcgcct
gctggaattgttacacagagtcccagtatcatggacttagtgaaatgtgacggtgcagca
tttctttaccacgggaagtattacccgttgggtgttgctcctagtgaagttcagataaaa
gatgttgtggagtggttgcttgcgaatcatgcggattcaaccggattaagcactgatagt
ttaggcgatgcggggtatcccggtgcagctgcgttaggggatgctgtgtgcggtatggca
gttgcatatatcacaaaaagagactttcttttttggtttcgatctcacactgcgaaagaa
atcaaatggggaggcgctaagcatcatccggaggataaagatgatgggcaacgaatgcat
cctcgttcgtcctttcaggcttttcttgaagttgttaagagccggagtcagccatgggaa
actgcggaaatggatgcgattcactcgctccagcttattctgagagactcttttaaagaa
tctgaggcggctatgaactctaaagttgtggatggtgtggttcagccatgtagggatatg
gcgggggaacaggggattgatgagttaggtgcagttgcaagagagatggttaggctcatt
gagactgcaactgttcctatattcgctgtggatgccggaggctgcatcaatggatggaac
gctaagattgcagagttgacaggtctctcagttgaagaagctatggggaagtctctggtt
tctgatttaatatacaaagagaatgaagcaactgtcaataagcttctttctcgtgctttg
agaggggacgaggaaaagaatgtggaggttaagctgaaaactttcagccccgaactacaa
gggaaagcagtttttgtggttgtgaatgcttgttccagcaaggactacttgaacaacatt
gtcggcgtttgttttgttggacaagacgttactagtcagaaaatcgtaatggataagttc
atcaacatacaaggagattacaaggctattgtacatagcccaaaccctctaatcccgcca
atttttgctgctgacgagaacacgtgctgcctggaatggaacatggcgatggaaaagctt
acgggttggtctcgcagtgaagtgattgggaaaatgattgtcggggaagtgtttgggagc
tgttgcatgctaaagggtcctgatgctttaaccaagttcatgattgtattgcataatgcg
attggtggccaagatacggataagttccctttcccattctttgaccgcaatgggaagttt
gttcaggctctattgactgcaaacaagcgggttagcctcgagggaaaggttattggggct
ttctgtttcttgcaaatcccgagccctgagctgcagcaagctttagcagtccaacggagg
caggacacagagtgtttcacgaaggcaaaagagttggcttatatttgtcaggtgataaag
aatcctttgagcggtatgcgtttcgcaaactcattgttggaggccacagacttgaacgag
gaccagaagcagttacttgaaacaagtgtttcttgcgagaaacagatctcaaggatcgtc
ggggacatggatcttgaaagcattgaagacggttcatttgtgctaaagagggaagagttt
ttccttggaagtgtcataaacgcgattgtaagtcaagcgatgttcttattaagggacaga
ggtcttcagctgatccgtgacattcccgaagagatcaaatcaatagaggtttttggagac
cagataaggattcaacagctcctggctgagtttctgctgagtataatccggtatgcacca
tctcaagagtgggtggagatccatttaagccaactttcaaagcaaatggctgatggattc
gccgccatccgcacagaattcagaatggcgtgtccaggtgaaggtctgcctccagagcta
gtccgagacatgttccatagcagcaggtggacaagccctgaaggtttaggtctaagcgta
tgtcgaaagattttaaagctaatgaacggtgaggttcaatacatccgagaatcagaacgg
tcctatttcctcatcattctggaactccctgtacctcgaaagcgaccattgtcaactgct
agtggaagtggtgacatgatgctgatgatgccatattag

DBGET integrated database retrieval system