KEGG   Arabidopsis thaliana (thale cress): AT2G19450Help
Entry
AT2G19450         CDS       T00041                                 

Gene name
TAG1
Definition
diacylglycerol O-acyltransferase 1
Orthology
K11155  
diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ath00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 520 aa AA seqDB search
MAILDSAGVTTVTENGGGEFVDLDRLRRRKSRSDSSNGLLLSGSDNNSPSDDVGAPADVR
DRIDSVVNDDAQGTANLAGDNNGGGDNNGGGRGGGEGRGNADATFTYRPSVPAHRRARES
PLSSDAIFKQSHAGLFNLCVVVLIAVNSRLIIENLMKYGWLIRTDFWFSSRSLRDWPLFM
CCISLSIFPLAAFTVEKLVLQKYISEPVVIFLHIIITMTEVLYPVYVTLRCDSAFLSGVT
LMLLTCIVWLKLVSYAHTSYDIRSLANAADKANPEVSYYVSLKSLAYFMVAPTLCYQPSY
PRSACIRKGWVARQFAKLVIFTGFMGFIIEQYINPIVRNSKHPLKGDLLYAIERVLKLSV
PNLYVWLCMFYCFFHLWLNILAELLCFGDREFYKDWWNAKSVGDYWRMWNMPVHKWMVRH
IYFPCLRSKIPKTLAIIIAFLVSAVFHELCIAVPCRLFKLWAFLGIMFQVPLVFITNYLQ
ERFGSTVGNMIFWFIFCIFGQPMCVLLYYHDLMNRKGSMS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttggattctgctggcgttactacggtgacggagaacggtggcggagagttc
gtcgatcttgataggcttcgtcgacggaaatcgagatcggattcttctaacggacttctt
ctctctggttccgataataattctccttcggatgatgttggagctcccgccgacgttagg
gatcggattgattccgttgttaacgatgacgctcagggaacagccaatttggccggagat
aataacggtggtggcgataataacggtggtggaagaggcggcggagaaggaagaggaaac
gccgatgctacgtttacgtatcgaccgtcggttccagctcatcggagggcgagagagagt
ccacttagctccgacgcaatcttcaaacagagccatgccggattattcaacctctgtgta
gtagttcttattgctgtaaacagtagactcatcatcgaaaatcttatgaagtatggttgg
ttgatcagaacggatttctggtttagttcaagatcgctgcgagattggccgcttttcatg
tgttgtatatccctttcgatctttcctttggctgcctttacggttgagaaattggtactt
cagaaatacatatcagaacctgttgtcatctttcttcatattattatcaccatgacagag
gttttgtatccagtttacgtcaccctaaggtgtgattctgcttttttatcaggtgtcact
ttgatgctcctcacttgcattgtgtggctaaagttggtttcttatgctcatactagctat
gacataagatccctagccaatgcagctgataaggccaatcctgaagtctcctactacgtt
agcttgaagagcttggcatatttcatggtcgctcccacattgtgttatcagccaagttat
ccacgttctgcatgtatacggaagggttgggtggctcgtcaatttgcaaaactggtcata
ttcaccggattcatgggatttataatagaacaatatataaatcctattgtcaggaactca
aagcatcctttgaaaggcgatcttctatatgctattgaaagagtgttgaagctttcagtt
ccaaatttatatgtgtggctctgcatgttctactgcttcttccacctttggttaaacata
ttggcagagcttctctgcttcggggatcgtgaattctacaaagattggtggaatgcaaaa
agtgtgggagattactggagaatgtggaatatgcctgttcataaatggatggttcgacat
atatacttcccgtgcttgcgcagcaagataccaaagacactcgccattatcattgctttc
ctagtctctgcagtctttcatgagctatgcatcgcagttccttgtcgtctcttcaagcta
tgggcttttcttgggattatgtttcaggtgcctttggtcttcatcacaaactatctacag
gaaaggtttggctcaacggtggggaacatgatcttctggttcatcttctgcattttcgga
caaccgatgtgtgtgcttctttattaccacgacctgatgaaccgaaaaggatcgatgtca
tga

DBGET integrated database retrieval system