KEGG   Arabidopsis thaliana (thale cress): AT2G19760Help
Entry
AT2G19760         CDS       T00041                                 

Gene name
PRF1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT2G19760 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 131 aa AA seqDB search
MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL
APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE
RLGDYLIESEL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaatcatacgtcgatgatcaccttatgtgtgatgtcgaaggcaaccatctc
accgccgccgcaattctcggccaagacggcagtgtctgggctcagagcgccaaatttcct
cagttgaagcctcaagaaatcgatggaatcaagaaggactttgaggagcccgggtttctt
gccccaaccggactatttctcggtggcgaaaaatacatggttatccaaggtgaacaagga
gctgtgatccgagggaagaagggacctggaggtgtcactatcaagaagacaaaccaagct
ttggtctttggcttctacgatgaaccaatgactggaggtcaatgcaacttggttgtcgaa
aggctcggggattaccttatcgagtctgaactctaa

DBGET integrated database retrieval system