KEGG   Arabidopsis thaliana (thale cress): AT2G19770Help
Entry
AT2G19770         CDS       T00041                                 

Gene name
PRF5
Definition
profilin 5
Orthology
K05759  
profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 134 aa AA seqDB search
MSWQAYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQFKPQEITDIMKDFDEP
GHLAPTGMFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNM
VVERLGDYLIEQGL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaagcatacgttgatgagcatttgatgtgtgatgtcggcgacggccaaggt
caccaccttaccgccgccgctatcatcggccatgatggtagcgtttgggctcagagcgct
aattttcctcagttcaaacctcaagagatcacagacattatgaaggatttcgatgagcct
ggtcacctcgctcccacgggtatgttcctcgcagggctaaagtatatggtcatccaaggc
gagcctaatgctgtcatccgtggcaagaagggagctgggggaatcacgatcaagaaaaca
ggacaatcaatggtgtttggtctgtacgaagagccagtgactccaggacaatgcaacatg
gttgtcgagaggttgggtgattacttgatcgaacagggtctttga

DBGET integrated database retrieval system