KEGG   Arabidopsis thaliana (thale cress): AT2G19770Help
Entry
AT2G19770         CDS       T00041                                 

Gene name
PRF5
Definition
(RefSeq) profilin 5
  KO
K05759  profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Membrane trafficking [BR:ath04131]
 Others
  Actin-binding proteins
   Others
    AT2G19770 (PRF5)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     AT2G19770 (PRF5)
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT2G19770 (PRF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 816496
NCBI-ProteinID: NP_179567
MIPS: AT2G19770.1
TAIR: AT2G19770
Araport: AT2G19770
UniProt: Q38905 Q1PF40
Position
2
AA seq 134 aa AA seqDB search
MSWQAYVDEHLMCDVGDGQGHHLTAAAIIGHDGSVWAQSANFPQFKPQEITDIMKDFDEP
GHLAPTGMFLAGLKYMVIQGEPNAVIRGKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNM
VVERLGDYLIEQGL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaagcatacgttgatgagcatttgatgtgtgatgtcggcgacggccaaggt
caccaccttaccgccgccgctatcatcggccatgatggtagcgtttgggctcagagcgct
aattttcctcagttcaaacctcaagagatcacagacattatgaaggatttcgatgagcct
ggtcacctcgctcccacgggtatgttcctcgcagggctaaagtatatggtcatccaaggc
gagcctaatgctgtcatccgtggcaagaagggagctgggggaatcacgatcaagaaaaca
ggacaatcaatggtgtttggtctgtacgaagagccagtgactccaggacaatgcaacatg
gttgtcgagaggttgggtgattacttgatcgaacagggtctttga

DBGET integrated database retrieval system