KEGG   Arabidopsis thaliana (thale cress): AT2G20000Help
Entry
AT2G20000         CDS       T00041                                 

Gene name
HBT
Definition
cell division cycle protein 27-B
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT2G20000 (HBT)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AT2G20000 (HBT)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     AT2G20000 (HBT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 744 aa AA seqDB search
MEAMLVDCVNNSLRHFVYKNAIFMCERLCAEFPSEVNLQLLATSYLQNNQAYSAYHLLKG
TQMAQSRYLFALSCFQMDLLNEAESALCPVNEPGAEIPNGAAGHYLLGLIYKYTDRRKNA
AQQFKQSLTIDPLLWAAYEELCILGAAEEATAVFGETAALSIQKQYMQQLSTSLGLNTYN
EERNSTSTKNTSSEDYSPRQSKHTQSHGLKDISGNFHSHGVNGGVSNMSFYNTPSPVAAQ
LSGIAPPPLFRNFQPAVANPNSLITDSSPKSTVNSTLQAPRRKFVDEGKLRKISGRLFSD
SGPRRSSRLSADSGANINSSVATVSGNVNNASKYLGGSKLSSLALRSVTLRKGHSWANEN
MDEGVRGEPFDDSRPNTASTTGSMASNDQEDETMSIGGIAMSSQTITIGVSEILNLLRTL
GEGCRLSYMYRCQEALDTYMKLPHKHYNTGWVLSQVGKAYFELIDYLEAEKAFRLARLAS
PYCLEGMDIYSTVLYHLKEDMKLSYLAQELISTDRLAPQSWCAMGNCYSLQKDHETALKN
FLRAVQLNPRFAYAHTLCGHEYTTLEDFENGMKSYQNALRVDTRHYNAWYGLGMIYLRQE
KLEFSEHHFRMAFLINPSSSVIMSYLGTSLHALKRSEEALEIMEQAIVADRKNPLPMYQK
ANILVCLERLDEALEVLEELKEYAPSESSVYALMGRIYKRRNMHDKAMLHFGLALDMKPP
ATDVAAIKAAMEKLHVPDEIDESP
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatgcttgtggactgtgtaaacaacagtcttcgtcattttgtctacaaaaat
gctattttcatgtgcgagcgtctctgcgctgagtttccttctgaggttaatttgcagcta
ttagccaccagctacctgcagaataatcaagcttacagtgcatatcatctgctaaaggga
acacaaatggctcagtcccgatacttgttcgcattatcatgcttccagatggaccttctc
aatgaagctgaatctgcactctgccctgttaatgaacctggtgcggagatcccaaatggt
gcagcaggccattaccttcttggacttatttacaagtatactgatagaaggaagaatgct
gctcaacaatttaaacagtccttgacaatagaccctctactttgggctgcatatgaggaa
ttatgtatattaggtgctgctgaggaagcaactgcagtttttggtgaaacagctgctctc
tccattcaaaagcagtatatgcaacaactgtcaacttccctcggcttaaacacttacaac
gaggaacgtaattcaacttctactaaaaacacgagttctgaagattatagtccaaggcag
tctaaacacacacaaagccatggccttaaagatatctccggaaatttccattctcatgga
gttaatggaggtgtttcgaacatgtcattctataatacgccttcgccagtggctgcacag
ctatccggtatagctccaccaccacttttccggaattttcagccagctgttgcaaaccca
aactcccttattactgacagttctccaaagtccactgttaactctactcttcaagcacct
agaagaaagtttgtagatgaaggaaagttacgtaagatttctggcagactattttctgat
tctggtccacgacggagttcaagactgtctgctgattcaggggcaaacattaattcaagt
gttgcaacagtaagcggaaatgtgaacaacgcttccaagtatttgggaggttctaaattg
agttctttggcacttcgttctgtaacacttcggaagggacactcctgggcaaatgaaaac
atggatgaaggggtccgtggggaaccttttgatgattcaaggcctaatactgcctcaacg
actggttctatggcttccaatgatcaagaagacgaaacaatgtcgattggtggcatagca
atgagttctcaaacaatcacaattggtgtttcggaaattttaaacctccttaggacactc
ggagaagggtgtagactttcatacatgtacaggtgtcaggaggcactggatacgtatatg
aaacttccacataagcattataatacaggatgggttctttcccaggtcgggaaagcatac
tttgaactaattgactatttagaggctgaaaaggcattccgtcttgcccgtctggcttct
ccttattgcttagaaggaatggatatatactctacggtcctctatcatttgaaggaagac
atgaagctgagttacttggctcaggaactaatatcaaccgatcgcttagctcctcaatct
tggtgtgctatgggaaattgctatagcttgcaaaaggaccatgagaccgcactgaagaat
ttcctacgagctgttcaactgaatccaagatttgcatatgcacataccttatgtggccac
gaatacacaactcttgaggattttgagaacggaatgaaaagttaccaaaacgcacttcgt
gtagatacaagacactacaacgcatggtacgggcttggaatgatatatctacgccaagag
aagttagagttctcagagcatcacttcagaatggctttcctaataaacccgagttcctct
gttataatgtcttatttagggacatctttgcatgccttgaagagaagtgaggaagcacta
gagataatggagcaagccatagtagcagatagaaaaaaccctcttccaatgtaccagaaa
gctaacatacttgtctgcttagaaagattagatgaagctctagaagttcttgaggagctc
aaagagtatgcgccttcagagagcagcgtttacgctttaatgggcaggatctataagcgg
cgaaacatgcacgataaagccatgcttcatttcggtctagctttagatatgaaaccgcct
gcaactgacgttgctgcaataaaggctgcaatggagaaattgcatgttccagatgagatc
gatgagagcccgtga

DBGET integrated database retrieval system