KEGG   Arabidopsis thaliana (thale cress): AT2G20050Help
Entry
AT2G20050         CDS       T00041                                 

Definition
protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 1091 aa AA seqDB search
MGCAYSKTCIGQICATKENSIRQTHQQAPSRGGTRATAAAAAVEEDNPVFNFSSDAVDDV
DNDEIHQLGLSRDQEWGITRLSRVSSQFLPPDGSRVVKVPSCNYELRCSFLSQRGYYPDA
LDKANQDSFAIHTPFGSNSDDHFFGVFDGHGEFGAQCSQFVKRRLCENLLRHGRFRVDPA
EACNSAFLTTNSQLHADLVDDSMSGTTAITVMVRGRTIYVANAGDSRAVLAEKRDGDLVA
VDLSIDQTPFRPDELERVKLCGARVLTLDQIEGLKNPDVQCWGTEEDDDGDPPRLWVPNG
MYPGTAFTRSIGDSIAETIGVVANPEIAVVELTPDNPFFVVASDGVFEFISSQTVVDMVA
KHKDPRDACAAIVAESYRLWLQYETRTDDITIIVVHIDGLKDDAPRQLSSTGTQLQPPIP
QVVELTGSESPSTFGWNSKNQRVRHDLSRARIRAIENSLENGHAWVPPSPAHRKTWEEEA
HIERVLRDHFLFRKLTDSQCQVLLDCMQRLEANPGDIVVKQGGEGDCFYVVGSGEFEVLA
TQNGEVPRILQRYTAEKQSSFGELALMHNKPLQASVRAVDHGTLWALKREDFRGILMSEF
SNLASLKLLRSVDLLSRLTILQLSHVAESLSEACFSDGQTIVTKDQKLQGLYVIQKGRVK
ISFCTEVLESQNVSSLTTGITNEYDNLEIGTEVSIEKHEGSYFGEWALLGELKDSLSVVA
VGEVVCVVLTKENFESAVGPLTNISDDGPKTRHSSFELSKESAKVTDTTALAKATLADLE
WTTCLSTTDCSEIGLVHLKDKENLLSLKRFSKQKVKKLGKEAQVLKERNLMKNVIKPSAI
VPEILCTCVDQTFAAILLNTTLACPISSLLHSPLDESSVRFITGSLVSAIEDIHKNEILF
RGSSPELLMLDQSGYLQIVDFRFAKKLSGERTFTICGNADYLAPEIVQGKGHGYAADWWA
LGVLIYYMLEGEMPFGSWRESELDTFQKIAKGQLTFPRVLSSEAEDLITKLLEVDENLRF
GSQGGPESIKKHPWFNGLKWEAISNREFQVPQEIISRIHHHLENDNVLPLETSKSLDTTE
DQDAQNWLEEW
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtgcttattccaaaacttgcattggtcagatttgtgctacgaaagagaatagt
atcaggcaaacgcatcaacaagctccgtccagaggtggcacgagagctactgcggcggcg
gcggcggttgaggaggataatccggtgtttaatttctcttcagatgcggtggatgatgta
gataacgacgaaattcatcagcttggtttgagtagagaccaggaatgggggattactcgg
ctttctagggtttcttctcaatttctaccaccagatgggtcaagggttgtcaaggttccg
tcttgtaactatgaattgagatgctcgtttttgtctcaaagagggtattatcctgatgct
cttgataaggccaatcaagatagtttcgctattcatactccttttgggagtaattcggat
gatcatttctttggggtttttgatgggcatggtgagtttggtgctcagtgttctcagttt
gtgaagcggaggttgtgtgagaatcttcttagacatggtaggtttcgtgtggatcctgct
gaggcttgtaattcggctttcttgaccacgaattctcagttacatgctgatttggtagat
gatagtatgagtgggactactgcgattacggttatggttagaggaaggacgatatatgtg
gcgaatgcaggtgattccagggcggttttagctgagaagagggatggtgatcttgtagct
gttgatttgtctattgaccagactccttttagacctgatgagcttgaaagggttaagctt
tgtggtgctagagttcttactcttgatcagattgaaggcttgaaaaatcctgatgttcag
tgttggggtactgaggaagatgatgatggagaccctccgagactttgggtgcctaatgga
atgtatcctggaactgcttttaccaggagtattggtgattctattgcagagacaattggt
gttgttgctaaccctgagattgctgttgttgagctcacaccggataatcctttctttgtg
gttgctagtgatggcgtatttgagttcatctctagtcaaacggtggttgacatggttgca
aaacataaggatcctcgagatgcttgtgctgcaattgttgctgaatcatataggctatgg
ctacagtatgaaactcggacagatgatataacaatcatcgtcgtgcacattgatggacta
aaagatgatgctcctcggcaattgtcgagtacaggaactcaattgcagcctcctattcca
caagttgtggagcttacaggttcggaatctccttccacctttggatggaactctaaaaat
caacgtgtgaggcatgatctatctcgagctaggatacgtgccattgagaattcactagag
aatggacatgcttgggttcctccatctccagcccacagaaaaacctgggaagaagaagca
cacattgagcgggtgttgcgtgaccatttcctcttcaggaaactcactgattctcagtgc
caggttttgttggactgcatgcaaaggcttgaagctaatccaggggatattgttgtgaaa
cagggtggtgaaggggactgcttctacgttgtgggtagtggagaattcgaggtcttagca
actcagaacggtgaggtacctaggatcttgcagcgttatacagctgagaaacaatcatca
ttcggtgaactcgccttaatgcataacaagccgcttcaggcttctgtacgtgctgtagat
cacggaacattgtgggccttaaaaagagaagattttcgaggaattttgatgtctgagttt
tcaaacttagcatccttgaagcttcttcgttctgtcgatcttctttcccgtcttacaatt
ttgcaactaagccatgttgcagagtctctttccgaagcttgcttttctgatggacaaaca
attgttaccaaggaccaaaaacttcagggcctgtatgttatccagaagggacgcgtaaaa
atatctttctgtacagaggtgttggagagtcaaaatgtttcaagccttacaactggaatc
actaacgagtatgacaatcttgaaatcggaacagaagtctccatagaaaagcatgaagga
agttactttggtgaatgggctcttcttggcgaactcaaagattccttaagtgtggttgca
gttggcgaagtggtttgtgtggttttaacaaaagaaaatttcgagtcagcggtcggccct
ctgaccaatatttcagatgacggtcccaagacaagacattcttcattcgagctgtcaaag
gaatctgcaaaagttaccgataccacagctcttgctaaagccactcttgcagacctggaa
tggacaacatgcttgagtacaacagactgtagtgagattgggctcgtgcatttgaaagat
aaagaaaatttgctcagcttgaaaagattttcaaagcaaaaggtgaaaaagttaggtaaa
gaggcacaagtattgaaagagcggaatctgatgaagaacgtaataaagccctcagctatt
gttcccgaaatcttgtgtacttgtgtcgatcaaacatttgcggcaatcttactgaacact
actcttgcctgtcctatctcttctctgcttcactctccgcttgacgagtcatctgtccgt
ttcattaccggctcacttgtgtctgccatagaagacatacacaagaacgagattctcttc
agaggttcatcccccgagttactgatgttggatcaatccggatatctacagattgtagac
ttcagattcgccaagaaattgtccggggaacgaacatttacaatctgtggaaatgcagat
tatttagccccagaaattgttcaaggcaaaggccatggttatgcagctgactggtgggct
cttggagttttgatctactatatgctagaaggagaaatgccattcgggtcatggagagag
agcgagctcgacacgtttcagaagattgcaaaaggccaactaactttccctcgagttcta
agctcagaagctgaagatctcatcacaaagttgcttgaagttgatgaaaacctgcggttt
ggtagccaaggaggtccagaatcaatcaagaaacatccctggttcaatggtcttaaatgg
gaagctattagtaaccgcgaatttcaagttcctcaagagataatctcgcgaattcatcac
catttggagaatgataacgttctccctctagaaacttctaaatcgcttgacacaacagaa
gatcaagatgctcaaaactggcttgaagaatggtaa

DBGET integrated database retrieval system