KEGG   Arabidopsis thaliana (thale cress): AT2G20780Help
Entry
AT2G20780         CDS       T00041                                 

Definition
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 816607
NCBI-ProteinID: NP_179671
MIPS: AT2G20780.1
TAIR: AT2G20780
Araport: AT2G20780
UniProt: Q0WUU6 A0A178VXF5
Position
2
AA seq 526 aa AA seqDB search
MMKNLPEVGNGGGSGFPAVSVGNKKNKYQRMDSDAEESQNHREAEARNSRTRKYVMACAF
FASLNNVLLGYDVGVMSGAVLFIQQDLKITEVQTEVLIGSLSIISLFGSLAGGRTSDSIG
RKWTMALAALVFQTGAAVMAVAPSFEVLMIGRTLAGIGIGLGVMIAPVYIAEISPTVARG
FFTSFPEIFINLGILLGYVSNYAFSGLSVHISWRIMLAVGILPSVFIGFALCVIPESPRW
LVMKGRVDSAREVLMKTNERDDEAEERLAEIQLAAAHTEGSEDRPVWRELLSPSPVVRKM
LIVGFGIQCFQQITGIDATVYYSPEILKEAGIQDETKLLAATVAVGVTKTVFILFATFLI
DSVGRKPLLYVSTIGMTLCLFCLSFTLTFLGQGTLGITLALLFVCGNVAFFSIGMGPVCW
VLTSEIFPLRLRAQASALGAVGNRVCSGLVAMSFLSVSRAITVGGTFFVFSLVSALSVIF
VYVLVPETSGKSLEQIELMFQGGLERKDGEVELGDAERLVRKEQEF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaatcttccggaggttggtaatggcggtggctcgggttttccggcggtctct
gtcggaaataagaagaataagtatcagagaatggactccgacgcggaggaatcgcagaat
catcgtgaagcagaggctagaaacagtagaaccagaaaatacgttatggcttgtgccttt
tttgcatccttgaacaatgttcttctcggctacgatgttggggtaatgagcggtgcggtg
ttgttcatacagcaggatctcaaaataacggaggtgcagacggaagtgctcattggtagc
cttagcatcatctcactctttggcagcttagccggcggcagaacctctgactctatcggt
agaaaatggaccatggccttggctgctctcgtcttccagactggtgctgccgtgatggct
gtcgctccgtctttcgaggttttgatgatagggagaactttagccggcattgggattggg
cttggtgtcatgatcgctcctgtctacatcgccgagatatcccccaccgtagctagagga
tttttcacttcgttccctgagatcttcataaatctagggatcttgctgggctatgtttcg
aactacgctttctcggggctttccgtgcatatcagctggaggatcatgcttgcagttggg
attcttccttcggtgttcataggatttgcgctgtgtgtgatccctgagtcgccgaggtgg
ctggtgatgaaaggccgagtggacagtgcacgagaggtgctcatgaaaacgaatgagcga
gatgacgaagcggaagagcggcttgcagagatacaactggcggctgcacatacagaaggc
agcgaggacaggcccgtgtggcgtgagcttcttagcccatctcctgttgtacggaaaatg
ctgattgttggatttggaatccagtgtttccagcagatcacaggaattgacgccacagtc
tactatagtccagagatcctgaaagaggctgggatacaagacgagaccaaactgctcgct
gcaactgtcgctgttggtgtcacgaaaacagtgttcatactatttgccaccttcctgatt
gatagtgttggccggaaaccgctgctttatgtgagcacaataggaatgactctgtgtctc
ttttgtctaagctttacgctcacattcctcggccaaggaacgcttgggataaccttggcg
cttctctttgtttgtggaaacgttgccttcttctccataggaatgggacctgtttgctgg
gtcttgacatcagagatctttccattacgattaagagcccaggcatctgcgcttggggcg
gttgggaacagggtgtgcagcggtctggtggccatgtccttcctctctgtgtcacgtgcc
atcactgttggaggaaccttcttcgttttctccctcgtgtctgcactctcagttatcttc
gtgtatgtgctagtccccgagacaagcgggaagtcactggagcagatagagttgatgttt
cagggtgggctggaaagaaaagacggtgaagttgagcttggagatgctgagcgtcttgtg
cgcaaggaacaggagttttga

DBGET integrated database retrieval system