KEGG   Arabidopsis thaliana (thale cress): AT2G21610Help
Entry
AT2G21610         CDS       T00041                                 

Gene name
PE11
Definition
pectinesterase 11
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ath00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ath00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 352 aa AA seqDB search
MGLYKTKSKRSIANYHHIIIINIFILSSITSSSMASSSSPSSIDFSTAILIRVDQSGKGD
FSKIQEAIESIPPNLNNSQLYFIWVKPGIYREKVVIPAEKPYITLSGTQASNTFLIWSDG
EDILESPTLTIFASDFVCRFLTIQNKFGTAGRAVALRVAADKAAFYGCVITSYQDTLLDD
NGNHYFKNCYIEGATDFICGSASSLYERCHLHSLSPNNGSITAQMRTSATEKSGFTFLGC
KLTGSGSTFLGRPWGAYSRVVFAYSFFSNVVAPQGWNQWGDSTKENTVYYGEYKCYGPGA
DREQRVEWSKQLSDEEATVFLSKDFIGGKDWLRPAPSHFKNAPKQTQNKEIN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggactttataaaacgaagtccaaacgttcaattgctaactatcatcatatcataatc
atcaatattttcatcctctcttcaatcacatcttcttccatggcttcttcttcttctcca
tcttccattgatttttcgactgcaattctaataagagttgatcaatcgggcaaaggagac
ttcagtaagattcaagaagcaattgaatctatccctcccaatctaaacaactctcaactc
tatttcatttgggttaagcctggaatttaccgagaaaaagtggtgatacctgcggagaaa
ccctacataacattgagtgggacacaagcttccaacacttttctcatatggagcgatggc
gaagacattttggaatcacccactctcactatctttgcatccgattttgtatgccgattt
ctcactattcagaataagtttggaacggcgggacgtgcggttgcactgagggtggcggcg
gataaggcagcgttctacggatgcgtgataacgtcgtaccaagacactctccttgacgac
aatggaaaccattacttcaagaactgctatattgaaggagccaccgatttcatttgtgga
agcgcttcttctctatatgaaaggtgtcatttacactcgttgtcgccgaataatgggtct
ataacggcgcaaatgagaacgtcggccacagagaaatcaggctttacattcttgggatgc
aagttaactggatcaggttccacatttttgggaagaccatggggagcttattctagggtt
gtctttgcttattccttcttctccaatgtcgtcgcacctcaaggatggaaccaatgggga
gattcaaccaaagaaaatactgtatattatggtgaatacaaatgttatggtcccggagca
gacagggaacaaagagtagaatggtcaaaacagttatcggatgaagaagctaccgtcttc
ttgagcaaggactttatcggcggcaaagactggctccgacctgccccttctcacttcaag
aatgctcccaaacaaacccaaaataaagaaattaattaa

DBGET integrated database retrieval system