KEGG   Arabidopsis thaliana (thale cress): AT2G22310Help
Entry
AT2G22310         CDS       T00041                                 

Gene name
UBP4
Definition
(RefSeq) ubiquitin-specific protease 4
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT2G22310 (UBP4)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT2G22310 (UBP4)
Ubiquitin system [BR:ath04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AT2G22310 (UBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
2
AA seq 365 aa AA seqDB search
MGAAGSKLEKALGDQFPEGERYFGFENFGNTCYCNSVLQALYFCAPFREQLLEHYANNKA
DAEENLLTCLADLFSQISSQKKKTGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNYLLN
ELVEILEKETQATKADNETSSSPEKIANVLKAPLANGVHKEPIVTWVHKIFQGILTNETR
CLRCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKR
MKIKKPPHILVIHLKRFKYMEQLGRYKKLSYRVVFPLELKLSNTVDEYVDIEYSLFAVVV
HVGSGPNHGHYVSLVKSHNHWLFFDDESVEIIEESAVQTFFGSSQEYSSNTDHGYILLYE
SLGTR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcggggtccaaactcgagaaagctctcggcgaccagttcccggaaggagaa
cgatacttcggtttcgaaaatttcggcaacacttgttactgtaacagtgttttgcaggct
ctttatttttgtgctccctttcgtgaacaattgcttgaacattatgcaaataataaagct
gatgctgaggagaatctcttgacctgcttggctgacttattttcgcagataagttcccag
aagaagaaaacaggagttatcgctccgaagcgctttgtgcaaaggttgaagaaacagaat
gagcttttccggagttatatgcatcaggatgcacatgagttcctgaattatttgctaaat
gaacttgttgagatcttagagaaagagacacaagccacaaaagcagacaatgaaacttca
tcatctcctgaaaagattgcaaatgtactgaaagctcccctggcaaatggtgttcataaa
gagccaattgttacttgggtgcacaagatttttcagggtatacttaccaacgagacaagg
tgtctacggtgtgagacagtaacagcaagagatgaaactttcctagacctgagccttgat
attgaacagaacagttcgataactagctgtttgaaaaacttcagctccacagagactcta
catgcagaagacaagtttttctgtgacaaatgctgcagtttacaagaagcgcagaagaga
atgaagattaagaaaccgccacacatcttagttatacatctgaaacggttcaaatacatg
gaacagttgggccgctacaagaagctatcgtacagagtcgtcttccctctggaactgaaa
ctcagcaacacagtggatgaatatgtggacattgagtactctctctttgcagtcgtggtt
catgtcggaagtggacctaaccacggtcattatgttagcctcgtgaaatcccataaccac
tggctcttctttgatgatgagagtgtcgaaataattgaagaatctgctgttcaaacattc
ttcggttcatcgcaagagtactcaagtaatactgatcatggctacatcttgttatacgag
agcctcggaacaagatag

DBGET integrated database retrieval system