KEGG   Arabidopsis thaliana (thale cress): AT2G22310Help
Entry
AT2G22310         CDS       T00041                                 

Gene name
UBP4
Definition
ubiquitin carboxyl-terminal hydrolase 4
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT2G22310 (UBP4)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT2G22310 (UBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 379 aa AA seqDB search
MGAAGSKLEKALGDQFPEGERYFGFENFGNTCYCNSVLQDWVVDLRSVLHSMFALYFCAP
FREQLLEHYANNKADAEENLLTCLADLFSQISSQKKKTGVIAPKRFVQRLKKQNELFRSY
MHQDAHEFLNYLLNELVEILEKETQATKADNETSSSPEKIANVLKAPLANGVHKEPIVTW
VHKIFQGILTNETRCLRCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLHAEDKF
FCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKYMEQLGRYKKLSYRVVFPLELKLSNTVD
EYVDIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDESVEIIEESAVQTFFGSSQE
YSSNTDHGYILLYESLGTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcggggtccaaactcgagaaagctctcggcgaccagttcccggaaggagaa
cgatacttcggtttcgaaaatttcggcaacacttgttactgtaacagtgttttgcaggac
tgggttgttgatcttaggtctgttttgcattctatgtttgctctttatttttgtgctccc
tttcgtgaacaattgcttgaacattatgcaaataataaagctgatgctgaggagaatctc
ttgacctgcttggctgacttattttcgcagataagttcccagaagaagaaaacaggagtt
atcgctccgaagcgctttgtgcaaaggttgaagaaacagaatgagcttttccggagttat
atgcatcaggatgcacatgagttcctgaattatttgctaaatgaacttgttgagatctta
gagaaagagacacaagccacaaaagcagacaatgaaacttcatcatctcctgaaaagatt
gcaaatgtactgaaagctcccctggcaaatggtgttcataaagagccaattgttacttgg
gtgcacaagatttttcagggtatacttaccaacgagacaaggtgtctacggtgtgagaca
gtaacagcaagagatgaaactttcctagacctgagccttgatattgaacagaacagttcg
ataactagctgtttgaaaaacttcagctccacagagactctacatgcagaagacaagttt
ttctgtgacaaatgctgcagtttacaagaagcgcagaagagaatgaagattaagaaaccg
ccacacatcttagttatacatctgaaacggttcaaatacatggaacagttgggccgctac
aagaagctatcgtacagagtcgtcttccctctggaactgaaactcagcaacacagtggat
gaatatgtggacattgagtactctctctttgcagtcgtggttcatgtcggaagtggacct
aaccacggtcattatgttagcctcgtgaaatcccataaccactggctcttctttgatgat
gagagtgtcgaaataattgaagaatctgctgttcaaacattcttcggttcatcgcaagag
tactcaagtaatactgatcatggctacatcttgttatacgagagcctcggaacaagatag

DBGET integrated database retrieval system