KEGG   Arabidopsis thaliana (thale cress): AT2G22480Help
Entry
AT2G22480         CDS       T00041                                 

Gene name
PFK5
Definition
6-phosphofructokinase 5
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT2G22480 (PFK5)
   01230 Biosynthesis of amino acids
    AT2G22480 (PFK5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT2G22480 (PFK5)
   00030 Pentose phosphate pathway
    AT2G22480 (PFK5)
   00051 Fructose and mannose metabolism
    AT2G22480 (PFK5)
   00052 Galactose metabolism
    AT2G22480 (PFK5)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AT2G22480 (PFK5)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT2G22480 (PFK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 537 aa AA seqDB search
MDALSQAISSGISVPYKNNSSSLVPSHGLTSLILRKSRSPVNPSSRSRVSVRASEIQHSK
TSASSIDLSDPDWKLKYEKDFEQRFSIPHITDVLPDAEAIRSTFCLKMRSPTEDFVGGYP
SDEEWHGYINNNDRVLLKVISYSSPTSAGAECLDHDCSWVEQWIHRAGPREKIYFRPEEV
KAAIITCGGLCPGLNDVIRHIVITLEIYGVKNIVGIPFGYRGFSDKDLTEMPLSRKVVQN
IHLSGGSLLGVSRGGPSVSEIVDSMEERGINMLFVLGGNGTHAGANAIHNECRKRKIKVA
VVGVPKTIDNDILHMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGIGVVKLMGRNSGFIA
MQASLASGQVDICLIPEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTNA
KDASGNAVLGDFGVYIQQETKKYFKEISTPIDVKYIDPTYMIRAVRANASDGILCTVLGQ
NAVHGAFAGYSGITVGIINTHYAYLPITEVIAYPKSVDPNSRMWHRCLTSTGQPDFI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctttctcaggcgatcagttccgggatctccgttccttacaagaacaattct
tcttctctcgttccttctcacggactcacctccttaatcctccggaaatcgagatctccg
gtgaatccctcatcacgatctcgcgtctcggtgcgagcttcggagattcaacacagcaaa
acctcagcttcatcgatcgatctcagcgatccagattggaaattaaagtatgagaaagat
ttcgagcaacgattcagcatacctcacatcactgatgtcttacctgatgctgaagccatt
cgttcaacgttttgtcttaagatgaggtctccgacggaagattttgttggtggttaccct
tctgatgaagaatggcatggatacattaataacaatgatagagttcttctcaaggttatt
agttactcctcacctacttctgctggagctgagtgccttgatcatgactgttcttgggtt
gaacaatggattcaccgtgctggtccgagggagaagatatacttcaggccggaagaagtg
aaagctgcgattatcacttgtggtggcctttgccctggtctcaatgatgtcatcagacat
attgtcattactcttgagatttatggtgttaagaacattgtggggattcctttcggttat
cgaggcttctctgataaagatctaactgaaatgccgttatcaaggaaagtggttcagaat
attcatttatctggaggaagtttgcttggagtttcacgtggaggcccgagtgtgagtgaa
attgtcgacagcatggaggagagaggaatcaacatgcttttcgtgctcggtggaaacgga
actcatgctggcgccaacgctatacacaatgagtgccgcaaaagaaagataaaggtagct
gtagttggtgtgccaaaaaccatcgacaatgatattttacatatggataaaacttttggg
tttgatactgctgttgaagaagctcaacgagcaattaactctgcttacattgaggcacat
agtgcttatcatggcattggcgttgtaaaactgatgggtcgtaacagtggtttcattgct
atgcaagcctctctagcaagtggacaagtcgacatctgtttgattcctgaggttcccttc
aatcttcatgggcctaatggtgtattgaagcatttgaagtaccttattgaaacaaaaggc
tctgctgtgatctgtgtagcagaaggagctggacagaattttcttgagaaaaccaatgcc
aaagatgcatctggaaacgccgtacttggtgatttcggtgtgtatattcaacaagagact
aagaagtatttcaaagaaataagtactccaatagatgtgaagtatattgatccaacatac
atgattcgcgctgtacgtgcaaatgcctcggatggtatcctctgcaccgttcttggacaa
aacgctgttcatggtgcgtttgctggatacagtggaatcacggtaggcataatcaacact
cactatgcatatttgccaatcactgaggtaattgcatatccaaaatcagtggatcctaat
agtcgaatgtggcatcgttgcttgacatcaacgggccaacccgatttcatctaa

DBGET integrated database retrieval system