KEGG   Arabidopsis thaliana (thale cress): AT2G22480Help
Entry
AT2G22480         CDS       T00041                                 

Gene name
PFK5
Definition
(RefSeq) phosphofructokinase 5
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00030  Pentose phosphate pathway
ath00051  Fructose and mannose metabolism
ath00052  Galactose metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
ath03018  RNA degradation
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT2G22480 (PFK5)
   00030 Pentose phosphate pathway
    AT2G22480 (PFK5)
   00051 Fructose and mannose metabolism
    AT2G22480 (PFK5)
   00052 Galactose metabolism
    AT2G22480 (PFK5)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AT2G22480 (PFK5)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AT2G22480 (PFK5)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT2G22480 (PFK5)
Messenger RNA biogenesis [BR:ath03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AT2G22480 (PFK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 816781
NCBI-ProteinID: NP_850025
MIPS: AT2G22480.1
TAIR: AT2G22480
Araport: AT2G22480
UniProt: Q8VYN6
Position
2
AA seq 537 aa AA seqDB search
MDALSQAISSGISVPYKNNSSSLVPSHGLTSLILRKSRSPVNPSSRSRVSVRASEIQHSK
TSASSIDLSDPDWKLKYEKDFEQRFSIPHITDVLPDAEAIRSTFCLKMRSPTEDFVGGYP
SDEEWHGYINNNDRVLLKVISYSSPTSAGAECLDHDCSWVEQWIHRAGPREKIYFRPEEV
KAAIITCGGLCPGLNDVIRHIVITLEIYGVKNIVGIPFGYRGFSDKDLTEMPLSRKVVQN
IHLSGGSLLGVSRGGPSVSEIVDSMEERGINMLFVLGGNGTHAGANAIHNECRKRKIKVA
VVGVPKTIDNDILHMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGIGVVKLMGRNSGFIA
MQASLASGQVDICLIPEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTNA
KDASGNAVLGDFGVYIQQETKKYFKEISTPIDVKYIDPTYMIRAVRANASDGILCTVLGQ
NAVHGAFAGYSGITVGIINTHYAYLPITEVIAYPKSVDPNSRMWHRCLTSTGQPDFI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctttctcaggcgatcagttccgggatctccgttccttacaagaacaattct
tcttctctcgttccttctcacggactcacctccttaatcctccggaaatcgagatctccg
gtgaatccctcatcacgatctcgcgtctcggtgcgagcttcggagattcaacacagcaaa
acctcagcttcatcgatcgatctcagcgatccagattggaaattaaagtatgagaaagat
ttcgagcaacgattcagcatacctcacatcactgatgtcttacctgatgctgaagccatt
cgttcaacgttttgtcttaagatgaggtctccgacggaagattttgttggtggttaccct
tctgatgaagaatggcatggatacattaataacaatgatagagttcttctcaaggttatt
agttactcctcacctacttctgctggagctgagtgccttgatcatgactgttcttgggtt
gaacaatggattcaccgtgctggtccgagggagaagatatacttcaggccggaagaagtg
aaagctgcgattatcacttgtggtggcctttgccctggtctcaatgatgtcatcagacat
attgtcattactcttgagatttatggtgttaagaacattgtggggattcctttcggttat
cgaggcttctctgataaagatctaactgaaatgccgttatcaaggaaagtggttcagaat
attcatttatctggaggaagtttgcttggagtttcacgtggaggcccgagtgtgagtgaa
attgtcgacagcatggaggagagaggaatcaacatgcttttcgtgctcggtggaaacgga
actcatgctggcgccaacgctatacacaatgagtgccgcaaaagaaagataaaggtagct
gtagttggtgtgccaaaaaccatcgacaatgatattttacatatggataaaacttttggg
tttgatactgctgttgaagaagctcaacgagcaattaactctgcttacattgaggcacat
agtgcttatcatggcattggcgttgtaaaactgatgggtcgtaacagtggtttcattgct
atgcaagcctctctagcaagtggacaagtcgacatctgtttgattcctgaggttcccttc
aatcttcatgggcctaatggtgtattgaagcatttgaagtaccttattgaaacaaaaggc
tctgctgtgatctgtgtagcagaaggagctggacagaattttcttgagaaaaccaatgcc
aaagatgcatctggaaacgccgtacttggtgatttcggtgtgtatattcaacaagagact
aagaagtatttcaaagaaataagtactccaatagatgtgaagtatattgatccaacatac
atgattcgcgctgtacgtgcaaatgcctcggatggtatcctctgcaccgttcttggacaa
aacgctgttcatggtgcgtttgctggatacagtggaatcacggtaggcataatcaacact
cactatgcatatttgccaatcactgaggtaattgcatatccaaaatcagtggatcctaat
agtcgaatgtggcatcgttgcttgacatcaacgggccaacccgatttcatctaa

DBGET integrated database retrieval system