KEGG   Arabidopsis thaliana (thale cress): AT2G22740Help
Entry
AT2G22740         CDS       T00041                                 

Gene name
SUVH6
Definition
histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AT2G22740 (SUVH6)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AT2G22740 (SUVH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 790 aa AA seqDB search
MEMGVMENLMVHTEISKVKSQSNGEVEKRGVSVLENGGVCKLDRMSGLKFKRRKVFAVRD
FPPGCGSRAMEVKIACENGNVVEDVKVVESLVKEEESLGQRDASENVSDIRMAEPVEVQP
LRICLPGGDVVRDLSVTAGDECSNSEQIVAGSGVSSSSGTENIVRDIVVYADESSLGMDN
LDQTQPLEIEMSDVAVAKPRLVAGRKKAKKGIACHSSLKVVSREFGEGSRKKKSKKNLYW
RDRESLDSPEQLRILGVGTSSGSSSGDSSRNKVKETLRLFHGVCRKILQEDEAKPEDQRR
KGKGLRIDFEASTILKRNGKFLNSGVHILGEVPGVEVGDEFQYRMELNILGIHKPSQAGI
DYMKYGKAKVATSIVASGGYDDHLDNSDVLTYTGQGGNVMQVKKKGEELKEPEDQKLITG
NLALATSIEKQTPVRVIRGKHKSTHDKSKGGNYVYDGLYLVEKYWQQVGSHGMNVFKFQL
RRIPGQPELSWVEVKKSKSKYREGLCKLDISEGKEQSPISAVNEIDDEKPPLFTYTVKLI
YPDWCRPVPPKSCCCTTRCTEAEARVCACVEKNGGEIPYNFDGAIVGAKPTIYECGPLCK
CPSSCYLRVTQHGIKLPLEIFKTKSRGWGVRCLKSIPIGSFICEYVGELLEDSEAERRIG
NDEYLFDIGNRYDNSLAQGMSELMLGTQAGRSMAEGDESSGFTIDAASKGNVGRFINHSC
SPNLYAQNVLYDHEDSRIPHVMFFAQDNIPPLQELCYDYNYALDQVRDSKGNIKQKPCFC
GAAVCRRRLY
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgggagttatggagaatttgatggtacatacggagatatcaaaggttaagtct
cagagcaatggtgaggtggagaaacgaggagtgtcagttttggagaatggtggtgtttgc
aagcttgatcgaatgagtgggcttaagtttaagcgtcggaaggtttttgctgtgagggac
tttccaccgggttgtggttcgagagcaatggaagtgaagattgcttgtgagaatgggaat
gttgttgaagatgttaaggttgttgagtctttggttaaagaggaggagagtttggggcag
agagatgcctctgaaaacgtgagtgatatcagaatggctgagccggtggaggttcagcct
ctgagaatttgtttgccaggaggtgatgtggtaagagacttgtctgttaccgcgggagac
gagtgttcaaacagtgaacagattgtggcgggttctggtgttagcagcagcagcggaact
gaaaacattgtcagggatatcgttgtttacgcagatgagagcagtctaggaatggataat
ttggatcaaactcagccgctagaaattgaaatgtcagatgttgcagttgcaaaaccgagg
cttgttgcgggtagaaagaaggcaaagaaaggaattgcatgtcattcatccttgaaggtt
gttagccgagagtttggtgaaggatctaggaagaagaagagtaagaagaatttatattgg
cgtgatagggaaagtctggattctcctgagcagcttcggatactaggtgttgggacaagc
agcggttcaagcagcggtgatagtagtcggaacaaagtaaaggaaactctacgtcttttc
catggcgtttgcagaaagattctgcaggaggatgaagcaaagcctgaggaccaaaggaga
aaaggtaaaggtcttagaatagattttgaggcttcgaccattctcaaaaggaatggcaaa
tttctcaactctggtgtgcatattttgggagaagtgcctggggttgaggttggtgatgag
ttccaatataggatggagctgaacattcttggtatacataaaccaagccaggccggtatc
gattatatgaaatatggtaaggccaaagttgcgacaagtattgtagcctctggagggtat
gacgaccatctggataactcggatgtcttgacctacactggtcaaggcggaaacgtgatg
caagtaaagaagaagggagaggaactgaaagagcctgaagaccaaaagcttattaccgga
aacctcgcgttagcaaccagcatagaaaaacaaacccctgtgcgtgtcattagaggcaaa
cataagtcaactcatgataaatcaaaaggtggaaattatgtttacgacggattatatctt
gtggaaaagtattggcaacaagtcggatctcacggtatgaatgtcttcaagtttcaactt
aggcgcatacctggacaacctgaactttcttgggtagaggtgaagaaatctaagtcaaaa
taccgggaaggtctatgcaagcttgacatctcagaagggaaagagcagtcacccattagc
gctgtgaacgaaatagacgacgagaaaccgcctttgttcacctacactgttaaactgatt
tacccagattggtgcagaccagttcctccaaagtcatgctgttgcaccacgcgctgcacc
gaagctgaagcgagggtgtgcgcttgtgtggagaaaaacggtggagagataccgtacaac
ttcgatggagccattgttggtgcaaaacctactatctatgaatgtggcccactctgcaaa
tgcccttctagttgctacctaagagtcacacagcatgggatcaagttaccgcttgagatc
ttcaaaaccaagtcaagaggttggggagtgagatgtcttaagtcgatccctattggtagc
ttcatatgtgaatacgttggtgaacttttagaggatagtgaagcagaaagaagaatcggg
aacgacgagtatctctttgatattggtaacagatatgataactctttagctcaagggatg
tcagagctaatgctggggacacaggcaggccgatctatggcagaaggtgatgagtcgagt
ggattcaccattgatgcagcaagtaagggtaatgttgggaggttcataaaccatagctgc
tcgccaaatctgtacgcccaaaacgttttgtatgatcatgaagactctagaatccctcac
gtgatgttcttcgcacaggacaatatacctccgcttcaagaactctgttacgactacaat
tacgcgctcgatcaggtacgtgactctaagggtaatatcaagcagaaaccttgcttttgt
ggtgctgccgtatgtaggcgtaggctctattga

DBGET integrated database retrieval system