KEGG   Arabidopsis thaliana (thale cress): AT2G24270Help
Entry
AT2G24270         CDS       T00041                                 

Gene name
ALDH11A3
Definition
(RefSeq) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K00131  
glyceraldehyde-3-phosphate dehydrogenase (NADP+) [EC:1.2.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT2G24270 (ALDH11A3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT2G24270 (ALDH11A3)
   00030 Pentose phosphate pathway
    AT2G24270 (ALDH11A3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.9  glyceraldehyde-3-phosphate dehydrogenase (NADP+)
     AT2G24270 (ALDH11A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 496 aa AA seqDB search
MAGTGLFAEILDGEVYKYYADGEWKTSSSGKSVAIMNPATRKTQYKVQACTQEEVNAVME
LAKSAQKSWAKTPLWKRAELLHKAAAILKDNKAPMAESLVKEIAKPAKDSVTEVVRSGDL
ISYCAEEGVRILGEGKFLLSDSFPGNDRTKYCLTSKIPLGVVLAIPPFNYPVNLAVSKIA
PALIAGNSLVLKPPTQGAVSCLHMVHCFHLAGFPKGLISCITGKGSEIGDFLTMHPAVNC
ISFTGGDTGISISKKAGMIPLQMELGGKDACIVLDDADLDLVASNIIKGGFSYSGQRCTA
VKVVLVMESVADELVEKVKAKVAKLTVGPPEENSDITAVVSESSANFIEGLVMDAKEKGA
TFCQEYKREGNLIWPLLLDNVRPDMRIAWEEPFGPVVPVLRINSVEEGINHCNASNFGLQ
GCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGLKDSGIGSQGVTNSINLMTK
VKTTVINLPTPSYSMG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccgggactggattgtttgctgagattcttgatggagaagtatacaaatactacgct
gatggtgagtggaaaacttcttcctcaggtaagagtgttgccatcatgaacccggccacg
aggaagacacagtacaaggttcaagcatgcacgcaagaagaagtgaacgcggtgatggaa
ctggcgaaatcagctcagaaatcgtgggcgaaaactcctctttggaaaagagctgagctt
cttcacaaggctgcagcaatccttaaggacaacaaagctcccatggctgagtctcttgtt
aaagaaatcgctaaacccgccaaagattctgttactgaggttgtgaggtctggagatttg
atctcttattgtgctgaagaaggtgttaggatcttaggtgaagggaagtttcttctctcc
gatagcttccccggtaatgaccgtactaagtactgcctcacttccaagattccactcggt
gtggttttggctattcctccattcaattatccagttaatctcgctgtatcgaagatcgct
cctgctttgatcgccggaaactcccttgtcctcaaacctccaactcaaggagctgtttct
tgccttcacatggtacattgctttcacttagccggtttcccaaaaggtcttatcagctgc
atcaccggaaaaggatctgagatcggcgatttcctcactatgcaccctgctgttaactgc
attagtttcacgggtggtgataccggaatctcaatctcaaagaaagctggtatgatccct
cttcaaatggaacttggaggtaaagatgcatgcattgttctagatgatgctgatcttgat
ttagttgcttccaatatcatcaaaggaggattctcttacagcgggcagagatgcactgcg
gttaaggtagtcctagtgatggaatcagtagcggatgagcttgttgagaaagtgaaagct
aaagtggccaaactcacggtgggaccgcccgaagagaactccgatatcacggcagtggtg
tcggaatcttcagctaatttcattgaaggattggtgatggatgctaaggagaaaggagca
acgttttgtcaagagtataaaagagagggtaacttgatttggccgttgcttttggataat
gttagaccggacatgaggatcgcgtgggaggaaccattcggtcctgttgtgccggtcttg
aggatcaattctgttgaagaagggattaatcattgcaatgcaagcaactttggccttcag
ggatgtgtattcactaaagacatcaacaaggcaatactgatcagtgatgcaatggagaca
ggaaccgttcagatcaactctgcgccagctcgtggaccggaccacttccctttccaggga
cttaaggacagtggaatagggtcacaaggtgtgacaaatagcatcaatttgatgactaaa
gtgaagaccactgtcattaacttgcctacaccttcttactctatgggttag

DBGET integrated database retrieval system