KEGG   Arabidopsis thaliana (thale cress): AT2G24490Help
Entry
AT2G24490         CDS       T00041                                 

Gene name
RPA2
Definition
replicon protein A2
Orthology
K10739  
replication factor A2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AT2G24490 (RPA2)
   03420 Nucleotide excision repair
    AT2G24490 (RPA2)
   03430 Mismatch repair
    AT2G24490 (RPA2)
   03440 Homologous recombination
    AT2G24490 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 279 aa AA seqDB search
MFSSSQFEPNSGFSGGGFMSSQPSQAYESSSSTAKNRDFQGLVPVTVKQITECFQSSGEK
SGLVINGISLTNVSLVGLVCDKDESKVTEVRFTLDDGTGRIDCKRWVSETFDAREMESVR
DGTYVRLSGHLKTFQGKTQLLVFSVRPIMDFNEVTFHYIECIHFYSQNSESQRQQVGDVT
QSVNTTFQGGSNTNQATLLNPVVSSQNNDGNGRKNLDDMILDYLKQPACTARQQGIHIDE
IAQQLKIPKNKLEGVVQSLEGDGLIYSTIDEYHFKHVEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttctccagcagccaattcgagcctaattccggcttctccggcggcggattcatgtct
tctcaaccttctcaagcctacgaatcctcctcctccaccgctaagaatcgtgattttcaa
ggtcttgttccagtgacggtgaagcaaatcaccgaatgtttccaatccagtggtgaaaaa
tctggtctcgtcatcaatggaatctcactaacaaacgtttcacttgttggattagtgtgt
gacaaagatgaatctaaagtcacagaagttagattcactcttgatgatggaacaggacga
attgactgtaaaagatgggtgagtgaaactttcgacgctagagaaatggagtctgtgcga
gatggaacttatgtgcgcctcagtggtcatttgaagacttttcagggcaaaactcagctt
cttgttttctctgtgaggcctattatggacttcaatgaggttacttttcactacattgag
tgtatacacttctactcccagaactctgaatcacagagacaacaagtcggtgatgtcact
cagtcagttaacaccacatttcaaggtggatcaaacacaaaccaggcaacactattgaac
cctgtggtttcttctcaaaacaatgatggcaatgggcgcaagaacttggatgatatgatt
ctagactatctaaagcaacctgcttgcactgcaagacaacaggggatacatatcgatgaa
attgctcagcagttgaagatcccaaaaaacaagctagagggcgttgttcaatcactggaa
ggagatggtctaatatactcgacaatcgatgagtatcacttcaagcacgtggagctttga

DBGET integrated database retrieval system