KEGG   Arabidopsis thaliana (thale cress): AT2G24490Help
Entry
AT2G24490         CDS       T00041                                 

Gene name
RPA2
Definition
(RefSeq) replicon protein A2
  KO
K10739  replication factor A2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Module
ath_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AT2G24490 (RPA2)
   03420 Nucleotide excision repair
    AT2G24490 (RPA2)
   03430 Mismatch repair
    AT2G24490 (RPA2)
   03440 Homologous recombination
    AT2G24490 (RPA2)
DNA replication proteins [BR:ath03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT2G24490 (RPA2)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT2G24490 (RPA2)
   MMR (mismatch exicision repair)
     AT2G24490 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT2G24490 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon TrmB Rrf2 tRNA_anti_2 RMI2 PCI HTH_25 B-block_TFIIIC HTH_IclR RNA_pol_I_A49
Motif
Other DBs
NCBI-GeneID: 816985
NCBI-ProteinID: NP_001118376
MIPS: AT2G24490.1
TAIR: AT2G24490
Araport: AT2G24490
UniProt: Q9ZQ19 A0A178VTA7
Position
2
AA seq 279 aa AA seqDB search
MFSSSQFEPNSGFSGGGFMSSQPSQAYESSSSTAKNRDFQGLVPVTVKQITECFQSSGEK
SGLVINGISLTNVSLVGLVCDKDESKVTEVRFTLDDGTGRIDCKRWVSETFDAREMESVR
DGTYVRLSGHLKTFQGKTQLLVFSVRPIMDFNEVTFHYIECIHFYSQNSESQRQQVGDVT
QSVNTTFQGGSNTNQATLLNPVVSSQNNDGNGRKNLDDMILDYLKQPACTARQQGIHIDE
IAQQLKIPKNKLEGVVQSLEGDGLIYSTIDEYHFKHVEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttctccagcagccaattcgagcctaattccggcttctccggcggcggattcatgtct
tctcaaccttctcaagcctacgaatcctcctcctccaccgctaagaatcgtgattttcaa
ggtcttgttccagtgacggtgaagcaaatcaccgaatgtttccaatccagtggtgaaaaa
tctggtctcgtcatcaatggaatctcactaacaaacgtttcacttgttggattagtgtgt
gacaaagatgaatctaaagtcacagaagttagattcactcttgatgatggaacaggacga
attgactgtaaaagatgggtgagtgaaactttcgacgctagagaaatggagtctgtgcga
gatggaacttatgtgcgcctcagtggtcatttgaagacttttcagggcaaaactcagctt
cttgttttctctgtgaggcctattatggacttcaatgaggttacttttcactacattgag
tgtatacacttctactcccagaactctgaatcacagagacaacaagtcggtgatgtcact
cagtcagttaacaccacatttcaaggtggatcaaacacaaaccaggcaacactattgaac
cctgtggtttcttctcaaaacaatgatggcaatgggcgcaagaacttggatgatatgatt
ctagactatctaaagcaacctgcttgcactgcaagacaacaggggatacatatcgatgaa
attgctcagcagttgaagatcccaaaaaacaagctagagggcgttgttcaatcactggaa
ggagatggtctaatatactcgacaatcgatgagtatcacttcaagcacgtggagctttga

DBGET integrated database retrieval system