KEGG   Arabidopsis thaliana (thale cress): AT2G24640Help
Entry
AT2G24640         CDS       T00041                                 

Gene name
UBP19
Definition
ubiquitin carboxyl-terminal hydrolase 19
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 502 aa AA seqDB search
MAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRRNDWCFLCEFENHLDRAN
YSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQSVCLDEFGGEKVVPPRAQ
ETTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEIHGDAVSLEECLDQFTAKEWLQ
GDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQGGRFGKLNKRISFPETFDLGPYM
SGGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKDFRGNWYRIDDSEVEKVELEDVLSQ
RAYMLLYSRVQPRPSNLRSEESQDEKKTDTLNTESNQDGSVESSGVGTNDTSVSSLCNGI
ISHSEDPEYEKESSLSASVPVSEEGKEVDVKVDTVDSESNRSIDMEHDSGTDHQEEEANG
KEDPTVENLAVDSSCLDITTPSPSAATEFIPQENERSDTESKPLEKEHSDTESNKPLEKE
HLDSESKPLEKEHSDTEMIDAQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggctccttgtgggctcaccaattgtggaaacagttgtttcgctaatgtggttctacaa
tgcctttcctggacacgccctcttgttgcttaccttctggagagaggccacaaaagagaa
tgtaggcgaaatgattggtgcttcttatgcgaatttgaaaatcatcttgacagagcaaac
tatagccggtttcctttttcaccaatgaacattatctcgcggctgcctaatattggtgga
aatcttgggtatgggagacaggaggatgctcatgagttgatgaggtttgcaattgatatg
atgcaatctgtttgcctcgacgaatttggtggagaaaaagtggtgcctcctcgcgcccaa
gagacaacacttattcaatatatatttggtggtctccttcagtcacaggtccagtgtact
gcttgcagtaatgtttctgaccaatatgaaaatatgatggatttaactgttgagatccat
ggggatgcggtatcattggaggaatgtctcgatcagtttacagctaaagaatggcttcag
ggagataacttatacaaatgtgatagatgtgatgactatgtgaaagcatgcaagcgcctt
tcaattcgttgtgctccaaatattcttacaattgccttaaaaagattccagggtgggaga
ttcggtaaactgaacaaaagaattagttttcctgagacatttgatctaggcccttacatg
agcggtggaggagaaggatcagatgtatacaaactctacgctgtgattgttcatctagat
atgttgaatgcttcatttttcggccattacatatgctatgtcaaggacttccgtggaaac
tggtatagaatagacgattctgaggtggaaaaggttgaactagaagatgtcctttctcaa
cgagcatacatgctcctctacagcagggttcagcccagaccatcaaatcttagatccgaa
gaaagtcaagatgagaagaaaacagatacattgaacacagaatctaaccaagatggctct
gttgagagttccggggtgggaacaaatgacacaagtgtgtcctcgctgtgtaacggcatc
atctcacattcagaagaccctgaatacgaaaaagaatcatcattgtcagcatccgtacca
gtctctgaagaaggaaaggaagttgacgtaaaggttgatacagtagattctgaatcaaac
cgttctattgacatggaacatgattctggaacagatcatcaagaagaagaagcaaatggg
aaagaagatccaacggttgaaaatctggctgttgattcttcttgtttggacattactact
ccatctccatctgctgctacagagttcatacctcaggagaacgaacgttcagacaccgag
tccaaacctctggagaaagaacattcagacaccgagtccaacaaaccgctggagaaagaa
catttagacagcgagtccaaacccctggagaaagaacattcagacaccgagatgatcgat
gctcaatga

DBGET integrated database retrieval system