KEGG   Arabidopsis thaliana (thale cress): AT2G26230Help
Entry
AT2G26230         CDS       T00041                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AT2G26230
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AT2G26230
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AT2G26230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 309 aa AA seqDB search
MAQEADGIRLDQRHGKARVRVGRVWRHAHDGSHHFVEWNVSISLLSHCLSSYRLDDNSDI
VATDTIKNTVYVKAKECGDRLSVEEFAILIGKHFCSFYPQVFTAIVNIIEKPWERVSIDG
KPHLHGFKLGSENHTTEARVEKSGALNLTSGIGGLALLKTTQSGFERFVRDKYTILPETR
ERMLATEVNASWRYSYESVASIPTKGLYFSEKFMDVKKVLMDTFFGPPETGVYSPSVQRT
LYLMGSAVLKRFADVSSIHLKMPNIHFLPVNLSTKENPSMVKFKDDVYLPTDEPHGSIEA
TLSRITSKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagaagccgatgggatcagattggaccaaagacatgggaaggctcgagtgaga
gttggaagagtttggcgtcatgctcatgatggatctcatcactttgttgaatggaatgtt
agcatcagtcttctctctcactgtctctcttcttaccgtcttgatgataactctgatatt
gtcgccacagataccattaaaaacactgtttatgtgaaagccaaggaatgtggagatcgg
ctctcggtggaggaatttgccatacttattgggaaacacttttgctcattttatccacag
gtatttactgctatcgtgaatatcattgagaagccctgggagcgtgtctccatcgatgga
aaaccacatttacatggttttaagcttgggtcagagaaccatactacagaggcaagagta
gaaaagtctggtgcattaaacttaacttccggtattggaggactagctctactgaagaca
acccagtcaggatttgagaggtttgtcagagacaaatacaccattctgcctgaaactcgt
gagcgaatgctggccacagaggttaatgcatcttggaggtactcgtatgagtcagttgca
agcattccaacaaaaggactctactttagcgagaagttcatggacgttaagaaagttctg
atggatactttctttggtccaccagaaactggtgtgtatagcccttctgtccaacgcact
ctctacctcatgggaagcgccgtactgaaaaggttcgctgatgtatcatcgattcaccta
aaaatgccaaatattcattttctaccagtaaatctttcaacgaaggaaaacccttcaatg
gtgaagtttaaagatgatgtgtacctgccaaccgatgaacctcatggatctatagaagca
actctaagccgtataacctcgaaactatga

DBGET integrated database retrieval system