KEGG   Arabidopsis thaliana (thale cress): AT2G26400Help
Entry
AT2G26400         CDS       T00041                                 

Gene name
ARD3
Definition
acireductone dioxygenase 3
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT2G26400 (ARD3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     AT2G26400 (ARD3)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     AT2G26400 (ARD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 199 aa AA seqDB search
MGEAAKDQTEEVIQAWYLDNKEEDQKLPHHKDPKEFVSLDKLAELGVLCWRLDADNYETD
EELKRIRESRGYSYMDLCEVCPEKLPNYEEKVKMFFEEHLHIDEEIRYCLAGSGYFDVRD
LNDIWIRVWVKKGGLIVFPAGIYHRFTVDSDNYMKAMRLFVGGPVWTAYNRPHDHLPARK
AYMKKFLKVIGDRNIDASA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagccgctaaggatcaaactgaagaagtgattcaagcttggtacttggataat
aaggaagaggatcagaaacttcctcaccacaaggatcctaaggaatttgtatctttggac
aaacttgcagagcttggagtactttgctggagacttgatgctgataactatgaaaccgat
gaggaattgaaaaggatccgcgaatctcgtggttactcctacatggacttatgtgaggtg
tgtccagagaagcttccaaactatgaagaaaaagtaaagatgttttttgaagaacattta
catattgatgaagagatccgttactgcctcgcaggaagtggatactttgatgtgagggat
ctcaatgatatttggattagagtatgggtaaagaagggaggtttgatagtcttccctgct
ggaatatatcatcgcttcaccgtggactcggacaactatatgaaggcaatgcgtcttttc
gtgggtggaccagtgtggactgcttataatcgcccacatgaccatcttcctgcaaggaaa
gcgtatatgaaaaaattcttgaaggtgattggggaccgtaacatagacgcttcagcgtaa

DBGET integrated database retrieval system