KEGG   Arabidopsis thaliana (thale cress): AT2G26540Help
Entry
AT2G26540         CDS       T00041                                 

Gene name
HEMD
Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT2G26540 (HEMD)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AT2G26540 (HEMD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 321 aa AA seqDB search
MALLLLSHCSILSFQPPLSSSSSFHSSHIQSLSKPVFASPSPIRNSISSSVSSSSSSVSS
SNSIPQVVVTRERGKNNQIIKALEKNGISSLELPLIQHARGPDFDRLASVLNDKSFDWII
ITSPEAGSVFLEAWKTASSPEVQIGVVGAGTARVFEEAMKSADGLLHVAFTPSKATGKVL
ASELPEKVGKRSSVLYPASLKAGNDIVEGLSKRGFEVVRLNTYTTVPVQSVDTVLLQQAL
SAPVLSVASPSAVRAWLHLIQNEEQWSNYVACIGETTASAARRLGLKNVYYPEKPGLEGW
VESIMEALGAHADSSNPSSRN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcattattactcctttctcactgctctatcttatcttttcaacctccattatcgtct
tcttcttcatttcattcttcacatatccaatctctgagcaaaccagttttcgcttctcct
tccccaattcgaaattcaatttcttcgtccgtctcttcatcttcttcctccgttagtagc
tccaattcgattcctcaggtcgtcgtaacacgagaacgaggcaagaacaatcaaatcatc
aaagctttggagaaaaatggcatatcatctttagagcttccgttgattcaacatgcgcga
ggacctgatttcgatcggcttgcttctgtattaaatgataagagctttgactggatcatc
ataacatctccagaagcaggttctgtttttctcgaggcgtggaagacagctagctcccca
gaagtgcaaataggtgtagtaggagctggaacagccagggtatttgaagaggcaatgaaa
tcggcagatggattgcttcatgttgcctttacaccatcaaaagcaactggtaaagtcttg
gcttcggagcttccagagaaagttggcaaaaggtcctctgtcttatacccggcttctcta
aaagcaggcaatgatattgtggaagggttgtccaaacgtgggtttgaagttgtcaggctg
aatacatacacaacagttccggtgcagagtgttgatacggtgctcctgcaacaggcacta
tctgctcctgttctttctgtagcttctccttctgcagttcgcgcctggctgcatctgatt
caaaatgaggagcaatggagcaattacgttgcctgcattggagagacaactgcatcagct
gctagaagactaggattgaaaaacgtctactacccagagaaaccaggacttgaagggtgg
gtcgagagcataatggaagctctaggtgctcacgcagattcaagtaaccctagcagcagg
aattga

DBGET integrated database retrieval system