KEGG   Arabidopsis thaliana (thale cress): AT2G26710Help
Entry
AT2G26710         CDS       T00041                                 

Gene name
BAS1
Definition
(RefSeq) cytochrome P450 734A1
  KO
K15639  
PHYB activation tagged suppressor 1 [EC:1.14.-.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Brassinosteroid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    AT2G26710 (BAS1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     AT2G26710 (BAS1)
Cytochrome P450 [BR:ath00199]
 Cytochrome P450, plant type
  CYP734 family
   AT2G26710 (BAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 520 aa AA seqDB search
MEEESSSWFIPKVLVLSVILSLVIVKGMSLLWWRPRKIEEHFSKQGIRGPPYHFFIGNVK
ELVGMMLKASSHPMPFSHNILPRVLSFYHHWRKIYGATFLVWFGPTFRLTVADPDLIREI
FSKSEFYEKNEAHPLVKQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKLLVPVVLKSVT
DMVDKWSDKLSENGEVEVDVYEWFQILTEDVISRTAFGSSYEDGRAVFRLQAQQMLLCAE
AFQKVFIPGYRFFPTRGNLKSWKLDKEIRKSLLKLIERRRQNAIDGEGEECKEPAAKDLL
GLMIQAKNVTVQDIVEECKSFFFAGKQTTSNLLTWTTILLSMHPEWQAKARDEVLRVCGS
RDVPTKDHVVKLKTLSMILNESLRLYPPIVATIRRAKSDVKLGGYKIPCGTELLIPIIAV
HHDQAIWGNDVNEFNPARFADGVPRAAKHPVGFIPFGLGVRTCIGQNLAILQAKLTLAVM
IQRFTFHLAPTYQHAPTVLMLLYPQHGAPITFRRLTNHED
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaaagtagcagctggttcattccaaaggttcttgttctgtctgtaatctta
agtcttgtaatagtgaagggtatgtctctgttatggtggagaccaagaaagattgaagaa
catttctctaaacaaggaattcgaggtcctccttatcatttcttcatcggaaatgttaaa
gaacttgttggaatgatgcttaaagcttcttctcatcctatgcctttctctcacaatatt
cttcctagagttctctctttttaccatcactggagaaaaatctacggtgctacatttctg
gtttggttcggtccaactttccggttaacggtagccgatcctgatttgatcagagagatc
ttctctaagtctgagttctacgagaagaatgaagctcaccctttggttaaacaacttgaa
ggcgatggactacttagtctcaaaggtgaaaaatgggctcatcatcgaaaaatcattagc
cctacttttcatatggagaatcttaagttgcttgtaccagttgtgttgaagagtgtgact
gatatggtggataaatggtccgataagttatcagaaaacggtgaagttgaggtagatgtc
tatgagtggtttcagattttgactgaagatgttattagtagaacagcttttggaagtagc
tatgaagatggtcgagcagtttttcgacttcaagctcaacaaatgcttctttgtgctgaa
gcttttcaaaaagtcttcattcctggctatagattttttccgacaagagggaatttgaag
tcttggaagttagacaaggagataaggaagtcgttgttgaagctgatagagcggcggaga
caaaacgctatagatggagaaggggaagaatgtaaggagccggcggcgaaggatttgttg
ggattaatgattcaggcaaagaatgtgacggttcaggacattgtggaggagtgtaaaagc
tttttcttcgccgggaaacagacaacttctaatctgctgacgtggacgaccatcttgcta
tccatgcacccggagtggcaggccaaagcacgtgatgaggtcctcagggtctgcggctca
cgtgatgtccctaccaaggaccatgtcgttaagcttaaaacgttgagtatgatcttgaac
gagtctttaaggttgtatccaccaatagtagctacgattcgacgcgctaaatcggatgtg
aagctaggagggtacaaaatcccatgtggcacggagcttctaatcccaatcatagcggtc
catcatgaccaagccatttggggtaatgacgtgaacgaattcaatccagctcggtttgcg
gatggagtgccgcgtgctgccaaacaccccgttggcttcataccgtttggcctcggagtt
cgtacatgcattggtcagaatcttgctatacttcaggccaaattgacactcgctgtaatg
atccaacgcttcacctttcacttggctcctacttatcagcatgcacctaccgtccttatg
ttgctttatcctcaacatggtgcaccaatcaccttccggagattgaccaatcatgaggat
tga

DBGET integrated database retrieval system