KEGG   Arabidopsis thaliana (thale cress): AT2G26930Help
Entry
AT2G26930         CDS       T00041                                 

Gene name
CDPMEK
Definition
(RefSeq) 4-(cytidine 5'-phospho)-2-C-methyl-D-erithritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00900  Terpenoid backbone biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT2G26930 (CDPMEK)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AT2G26930 (CDPMEK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C COG5
Motif
Other DBs
NCBI-GeneID: 817234
NCBI-ProteinID: NP_180261
MIPS: AT2G26930.1
TAIR: AT2G26930
Araport: AT2G26930
UniProt: O81014 A0A178VZZ2
Position
2
AA seq 383 aa AA seqDB search
MATASPPFISTLSFTHSSFKTSSSSSFSPKLLRPLLSFSVKASRKQVEIVFDPDERLNKI
GDDVDKEAPLSRLKLFSPCKINVFLRITGKREDGFHDLASLFHVISLGDTIKFSLSPSKS
KDRLSTNVQGVPVDGRNLIIKALNLYRKKTGSNRFFWIHLDKKVPTGAGLGGGSSNAATA
LWAANELNGGLVTENELQDWSSEIGSDIPFFFSHGAAYCTGRGEIVQDLPPPFPLDLPMV
LIKPREACSTAEVYKRLRLDQTSNINPLTLLENVTSNGVSQSICVNDLEPPAFSVLPSLK
RLKQRIIASGRGEYDAVFMSGSGSTIIGIGSPDPPQFIYDDEEYKNVFLSEANFMTREAN
EWYKEPASANATTSSAESRMDFQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcttctcctccatttatctcaactctcagcttcactcactcttctttcaaa
acttcttcttcttcttcattttctccgaagcttcttcgacccctcttaagcttttccgtc
aaagcttccagaaagcaagtagagatagtgtttgatcctgatgagaggcttaataagata
ggtgatgatgttgacaaagaagctcctttgtccaggcttaagctcttctcaccttgcaag
atcaatgttttcttgaggatcaccggaaagcgagaagatgggtttcatgatttagcctct
ttgtttcatgtgattagcttaggagacactattaaattctcattgtcaccatcaaagtct
aaagatcgtttgtctactaacgttcaaggagtccctgttgatgggagaaatctgattata
aaagcacttaacctttacaggaagaaaactggtagtaacagattcttctggattcattta
gataagaaggtgcctaccggggctggactcggtggtggaagtagtaatgctgcaactgca
ctctgggcggcaaatgagctcaatggaggtcttgtcactgagaacgaactccaggattgg
tcaagtgaaattgggtcagatattcctttcttcttctcgcatggagctgcctattgtacc
gggagaggtgagattgtccaagaccttcctccaccttttcctcttgatcttccgatggtg
ctcataaagccccgagaagcatgttccactgctgaagtttacaaacgtcttcgtttagat
cagacgagcaatattaatcccttgacattactagagaatgtgaccagcaatggtgtgtct
caaagcatatgcgtaaacgatttggaaccgccagcgttttcagttcttccatctctaaaa
cgcttgaagcaacggataatagcatctggacgtggggaatacgatgctgtgtttatgtct
gggagtggaagcactattatcggtattggttcaccagatcctcctcaatttatatatgat
gatgaagaatacaagaacgtgttcttgtctgaagcaaactttatgacgcgtgaggctaat
gaatggtacaaagaacctgcttctgcaaatgctactacctcatccgccgaatctcgcatg
gatttccaatga

DBGET integrated database retrieval system