KEGG   Arabidopsis thaliana (thale cress): AT2G27050Help
Entry
AT2G27050         CDS       T00041                                 

Gene name
EIL1
Definition
(RefSeq) ETHYLENE-INSENSITIVE3-like 1
  KO
K14514  ethylene-insensitive protein 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    AT2G27050 (EIL1)
   04075 Plant hormone signal transduction
    AT2G27050 (EIL1)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   Others
    AT2G27050 (EIL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIN3 DUF2841 Rieske
Motif
Other DBs
NCBI-GeneID: 817247
NCBI-ProteinID: NP_180273
MIPS: AT2G27050.1
TAIR: AT2G27050
Araport: AT2G27050
UniProt: Q9SLH0
Position
2
AA seq 584 aa AA seqDB search
MMMFNEMGMYGNMDFFSSSTSLDVCPLPQAEQEPVVEDVDYTDDEMDVDELEKRMWRDKM
RLKRLKEQQSKCKEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGI
IPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQSENNISGGSNDCNSLVGPTPHTL
QELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGNEEWWPQLGLPNEQGPPPYK
KPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVV
ARELYPESCPPLSSSSSLGSGSLLINDCSEYDVEGFEKEQHGFDVEERKPEIVMMHPLAS
FGVAKMQHFPIKEEVATTVNLEFTRKRKQNNDMNVMVMDRSAGYTCENGQCPHSKMNLGF
QDRSSRDNHQMVCPYRDNRLAYGASKFHMGGMKLVVPQQPVQPIDLSGVGVPENGQKMIT
ELMAMYDRNVQSNQTPPTLMENQSMVIDAKAAQNQQLNFNSGNQMFMQQGTNNGVNNRFQ
MVFDSTPFDMAAFDYRDDWQTGAMEGMGKQQQQQQQQQDVSIWF
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtttaacgagatgggaatgtatggaaacatggatttcttctcttcctccaca
tctctcgatgtgtgtccattaccacaagctgaacaagaacctgtagttgaagatgtcgac
tacaccgatgatgagatggatgtggatgagcttgagaagaggatgtggagagacaaaatg
cgtttgaaacgtctcaaggagcaacagagtaagtgtaaagaaggcgtcgatggttcgaaa
cagaggcagtcgcaagagcaagctaggaggaagaaaatgtctagagcccaagatgggatc
ttgaagtatatgttgaagatgatggaagtttgtaaagctcaaggctttgtttatggtatt
attcctgagaagggtaagcctgtgactggtgcttcggataatttgagggaatggtggaaa
gataaggttaggtttgatcgtaatggtccagctgctattgctaagtatcagtcagagaat
aatatttctggagggagtaatgattgtaacagcttggttggtccaacaccgcatacgctt
caggagcttcaggacacgactcttggttcgcttttatcggctttgatgcaacattgtgat
ccaccgcagagacggtttcctttggagaaaggagtttctccaccttggtggcctaatggg
aatgaagagtggtggcctcagcttggtttaccaaatgagcaaggtcctcctccttataag
aagcctcatgatttgaagaaagcttggaaagtcggtgttttaactgcggtgatcaagcat
atgtcgccggatattgcgaagatccgtaagcttgtgaggcaatcaaaatgcttgcaggat
aagatgacggcgaaagagagtgctacttggcttgccattattaaccaagaagaggttgtg
gctcgggagctttatcccgagtcatgccctcctctttcttcttcttcatcattaggaagc
gggtcgcttctcattaatgattgtagcgagtatgacgttgaaggtttcgagaaggaacaa
catggtttcgatgtggaagagcggaaaccagagatagtgatgatgcatcctctagcaagc
tttggggttgctaaaatgcaacattttcccataaaggaggaggtcgccaccacggtaaac
ttagagttcacgagaaagaggaagcagaacaatgatatgaatgttatggtaatggacaga
tcagcaggttacacttgtgagaatggtcagtgtcctcacagcaaaatgaatcttggattt
caagacaggagttcaagggacaaccaccagatggtttgtccatatagagacaatcgttta
gcgtatggagcatccaagtttcatatgggtggaatgaaactagtagttcctcagcaacca
gtccaaccgatcgacctatcgggcgttggagttccggaaaacgggcagaagatgatcacc
gagcttatggccatgtacgacagaaatgtccaaagcaaccaaacgcctcctactttgatg
gaaaaccaaagcatggtcattgatgcaaaagcagctcagaatcagcagctgaatttcaac
agtggcaatcaaatgtttatgcaacaagggacgaacaacggggttaacaatcggttccag
atggtgtttgattcgacaccattcgatatggcagcattcgattacagagatgattggcaa
accggagcaatggaaggaatggggaagcagcagcagcagcagcagcagcagcaagatgta
tcaatatggttctga

DBGET integrated database retrieval system