KEGG   Arabidopsis thaliana (thale cress): AT2G27220Help
Entry
AT2G27220         CDS       T00041                                 

Gene name
BLH5
Definition
(RefSeq) BEL1-like homeodomain 5
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: POX Homeobox_KN Homeobox Homez AHSP PriC
Motif
Other DBs
NCBI-GeneID: 817264
NCBI-ProteinID: NP_001318297
MIPS: AT2G27220.1
TAIR: AT2G27220
Araport: AT2G27220
UniProt: Q8S897 A0A178VX84
Position
2
AA seq 431 aa AA seqDB search
MAAFFLGESEMREHSSDLFMMTLNPFREQTTTTNAHDDHFYNLCFGSQQYRPRDEVGHIE
QGNSSISTFSNGGVFRALAPIYLKAAQELLNEIVNVGNGSHGAKQERPVSKESTIYGVED
INGGYKPGVAALQMKKAKLISMGEMVEQRYKQYHDQMQTIISSFEQAAGLGSANSYTHMA
LQTISKQFRAVKDMISLQIKQINKLLGQKEFDEQLKKLGKMAHHHSNAWRPQRGLPEKAV
SVLRSWLFEHFLHPYPRDLDKVMLAKQTGLTKSQVSNWFINARVRMWKPLVEELYSEEMD
IEESRKGSDRYSTKGSSSKQPYNNTTSNESSNTILPAFRQGFTETETPRQNSSSSCSVVM
RFTKQHMNQANFINFNGGFENYHTMDGNSVSLSLGLPHSCDQTFNNIHFESTSHGTENSA
IYSSSTYQIMD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttctttcttggagaatctgaaatgagagaacactcttctgatctttttatg
atgactctgaatccgtttcgcgagcagacaacgaccactaatgctcatgacgatcacttc
tacaacttgtgctttggttcccaacaatatagacctcgagatgaagtaggtcatatagaa
caaggaaattcttccatctccactttttcaaacggaggagtcttcagggctttggctccg
atctacttgaaagcggctcaagaattactcaatgagattgtcaatgttggaaacggtagc
cacggcgcaaaacaagagcgaccggtgagtaaagagtccacgatttatggagttgaggac
atcaatggtggctataagcctggcgtagctgctttgcaaatgaagaaagcaaaactcatc
tccatgggtgaaatggtggaacagagatacaagcaataccatgaccaaatgcagactata
atctcatcgtttgagcaagctgcgggtttaggctcagcaaactcatacacacatatggcg
ttacaaacaatatcaaagcagtttcgtgctgtaaaagacatgataagtttgcaaatcaag
caaataaacaagctcttgggacaaaaggaatttgacgagcagcttaagaagttgggaaag
atggcacatcaccattcaaatgcttggagaccgcagagaggtttgcccgaaaaagctgtt
tccgttctacgctcttggctctttgagcattttcttcatccatatccgagggatttggat
aaggtaatgcttgccaaacagactggccttactaagagtcaggtgtcaaattggttcatt
aatgctcgagttcgaatgtggaagccactggtggaggaactttattcggaagaaatggat
attgaagaaagcagaaaaggaagtgaccggtatagtaccaaaggttcatcttcaaagcaa
ccgtacaataatacaacttcaaatgaatcttcgaacacgatcctacccgcctttcgtcaa
ggattcactgaaactgaaacccctaggcaaaattcatcctcaagttgcagcgtagtcatg
aggttcacgaagcaacacatgaatcaagcgaacttcatcaatttcaacggagggttcgaa
aactatcacacaatggatggaaacagcgtctccctttccctcggcctgcctcattcttgt
gaccaaacctttaataacattcattttgagtcaacaagtcatggaactgagaactcggcc
atatattcatcttcaacttatcaaatcatggattag

DBGET integrated database retrieval system