KEGG   Arabidopsis thaliana (thale cress): AT2G27350Help
Entry
AT2G27350         CDS       T00041                                 

Definition
otubain-like histone deubiquitinase 1
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 506 aa AA seqDB search
MTRILVQRGSSGSSSNSSRPSSSSSSSSGSETQINNNIPVPPVTIDEEITDEKQEEVTVV
EKAECSDAKDVAVDSDEPADREDDEGLVVAENVHVQSEGIDCDSPVSGGSNSDSPPVPAP
PPKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRSHSENEG
YNSSDEHMPCYVPSHPGSGLEREHQFEAEIRYSKGFEIRRMLEDGNCLFRAVADQVYGDS
EAYDLARQMCMDYMEQERDHFSQFITEGFTSYLKRKRRDKVYGNNVEIQALAEMYNRPIH
IYSYSTEPINIFQGNYSTDTPPIRLSYHHGNHYNSLVDPHRLTVGAGLGFSSLSGRHVDK
EQVKAAIKAQQEHQIDNALLAEGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPK
ESSTSNAETSSSGATGPSGSDSKPAEAVKEKTVLSSSIEMVLSMGFSYAQAMEAYSIFGD
DVDSMVCYVLETSCGGNNRRKGKATE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgactcggattttggttcaaagaggttcatcaggcagttcttccaactctagccgtcct
tcttcctcatctagttcttcctcgggatcagaaacacagataaacaataatattccggtt
cctcctgttactatagatgaagaaattacggatgagaaacaagaagaggttactgtagtt
gaaaaagcagagtgttctgatgctaaagatgtagctgtggacagtgatgaacctgcggat
agagaagatgatgaagggttggtagttgcagaaaatgttcatgttcaaagtgaaggtata
gattgtgattctccagttagcggtggcagtaactctgattcaccacccgtaccagctcca
ccaccaaaaccttcttccactgtcaatcctggtagtaacagatcggttttgggaagtttt
ggcgctttacgaattggaccaacacgaagagctgctgggcctcgctctcttgtttccagt
aggagttcgccaactggatcacatccttcttctccaagatcacacagtgagaacgagggc
tataatagttctgatgagcatatgccatgctatgtgccctctcatcctggctctggcttg
gaaagagaacaccagtttgaagcagagattagatattcaaaaggatttgaaattaggcgg
atgttggaagatggaaattgtctttttcgagctgttgcagatcaagtatatggggactca
gaggcatatgacttggctagacaaatgtgcatggattacatggaacaagagagggatcac
ttttctcagttcataaccgaaggttttacctcttacttgaagaggaaaagaagagataag
gtctatggaaacaacgtagagatccaagctttagcagaaatgtacaataggccaatccac
atttactcatatagcacagagcctatcaacatatttcaaggaaactacagcacggataca
cctcccataaggctgagttaccaccacgggaatcattataattctttggtggatccacat
cggttgacagttggtgcaggacttggatttagtagccttagtgggagacacgtggacaag
gaacaggtgaaagctgctataaaggctcagcaagaacatcaaattgataatgcgctgtta
gcagaagggagattttactctgaccttgagcttacggaaaaggaaatagagcggtcggta
atggaagcttctcgtgctgagtatcttatggaatggtctaagccacgaattggtccaaag
gaatcatccacctcgaatgctgagacatcatcttctggagctacaggaccttcaggcagc
gattcgaaaccagcagaggcagtaaaagaaaagacggtgctgagcagcagtatcgagatg
gtattgtcgatgggatttagctacgcacaggccatggaagcttatagcatttttggggat
gacgttgactctatggtctgttatgtactggagacgagctgtggcggcaacaaccgacgc
aaaggcaaagccacggaatag

DBGET integrated database retrieval system