KEGG   Arabidopsis thaliana (thale cress): AT2G28720Help
Entry
AT2G28720         CDS       T00041                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT2G28720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 151 aa AA seqDB search
MAPKAGKKPAEKKPAEKAPAEEEKVAEKAPAEKKPKAGKKLPKEAVTGGVEKKKKRVKKS
TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSRE
IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaagccggaaagaaaccagcagagaaaaagcccgcagagaaagctccagca
gaagaagagaaagtagccgaaaaagcaccagcagagaagaaaccaaaagccggaaaaaaa
ctaccaaaagaagcagtcaccggaggagtcgagaagaagaagaaacgagtcaagaaaagc
acagagacatacaagatctacatcttcaaggtgttgaaacaagttcatccagatattgga
atctcaagtaaagctatggggattatgaacagttttatcaatgatatattcgagaaactt
gcgcaagaagcttcaaaattagctaggtataataagaaacctacgattacttctagggag
attcagacagctgttagactagtgttacctggtgaacttgctaagcatgctgtttctgaa
ggaactaaggctgttactaagtttactagctcttag

DBGET integrated database retrieval system