KEGG   Arabidopsis thaliana (thale cress): AT2G29400Help
Entry
AT2G29400         CDS       T00041                                 

Gene name
TOPP1
Definition
serine/threonine-protein phosphatase PP1 isozyme 1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    AT2G29400 (TOPP1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT2G29400 (TOPP1)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     AT2G29400 (TOPP1)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     AT2G29400 (TOPP1)
Spliceosome [BR:ath03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    AT2G29400 (TOPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 318 aa AA seqDB search
MAEKPAQEQEQKRAMEPAVLDDIIRRLVEFRNTRPGSGKQVHLSEGEIRQLCAVSKEIFL
QQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLL
LAYKIKYPENFFLLRGNHESASINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDD
RILCMHGGISPELKSLDQIRNIARPMDIPESGLVCDLLWSDPSGDVGWGMNDRGVSYTFG
ADKVAEFLEKHDMDLICRAHQVVEDGYEFFAERQLVTVFSAPNYCGEFDNAGAMMSIDES
LMCSFQILKPSEKKSPFL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagccggcgcaagagcaagagcagaagcgagcgatggaacctgcagttctc
gacgatattattcgtcgtttggttgagtttcggaacacgagacctggatcggggaagcaa
gttcatctcagtgaaggtgaaattcgtcagctttgtgctgtctccaaagaaatatttctt
caacagcccaatctgcttgaattggaagctcccatcaagatctgcggtgatattcatggg
cagtattcagatctattgaggctttttgagtatggagggttccctcccgaagctaattat
ttgttcttgggtgattatgttgaccgtggcaagcaaagcttggaaacaatatgtcttctt
ctagcttacaaaatcaagtaccctgagaacttcttcttgttgagagggaatcatgaatct
gcttccattaatcgtatttacggtttctatgatgagtgcaaacgcaggttcaatgtcaga
ctctggaaaatattcaccgattgctttaactgtcttcctgtggccgccttaattgatgac
agaatactatgtatgcatggtgggatttccccagagctgaaaagtttggaccagattaga
aatattgcacggccgatggatattccggagtctggtttggtatgtgatttactatggtcg
gatcctagtggagacgtaggctggggcatgaatgatcgtggtgtttcatacacttttgga
gctgacaaagtcgcagagttcttggagaaacatgacatggaccttatctgtcgtgcccac
caggttgttgaagatgggtatgagttctttgcagaaagacaacttgttacagtattttca
gctcccaactattgcggggaatttgacaacgctggcgcaatgatgagcattgatgagagc
ttaatgtgctcattccagattctaaagccgtcagaaaagaagtcgccttttctgtga

DBGET integrated database retrieval system