KEGG   Arabidopsis thaliana (thale cress): AT2G29640Help
Entry
AT2G29640         CDS       T00041                                 

Gene name
JOSL
Definition
Josephin-like protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
2
AA seq 360 aa AA seqDB search
MADSESKIYHERQRLQFCLLHCLNNLFQDKDAFTKESLNSIAEKLETNDPNKETWTPLSF
VLKPHHNTITGNYDVNVMITALEGKGKSVVWHDKRIGASSIDLDDADTLMGIVLNVPVKR
YGGLWRSRHWVVVRKINGVWYNLDSDLVVPQLFRDDDEVRGFLDQNLSLDVIGLIWNLPY
NANQLPLASNYRVVITHWSDLNGMFSHVTNYPLDFDVYPQVSSKVSAIYKATGTKRFNAN
TRPVTPGKQSSVKGPYYKNPGCTTSCGLRLPRKTECTAARLIKDLSCKFVMGLRLVVMRK
KKKKRSPPLKKASSSGISQPSVISVVNDNNHRSAAIEDCIQFINSSSSFTRSNSTCGSKS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggattccgaatctaaaatctatcacgaacgacaacgattacaattttgcctcttg
cactgcctcaacaatctatttcaggacaaagacgcattcactaaagaaagcttgaactca
atcgcagagaagctcgagaccaatgatccaaacaaagaaacatggacacctctctctttc
gtcctcaagcctcaccacaatacaatcactggtaactacgacgtaaacgtgatgattaca
gctcttgaaggaaaaggcaagagtgttgtttggcatgataagcgtattggagcttcttcg
attgatcttgatgatgcagatactttaatgggtattgtgttgaatgttcctgttaagaga
tatggtggactttggagaagtaggcattgggttgttgttagaaaaatcaatggtgtttgg
tataatttggatagtgatctcgttgtgccgcagctgtttagagatgatgatgaagttaga
gggttcttggatcaaaatctgagtttagacgtgattggattaatttggaacctgccatat
aatgccaatcaacttccattagcatctaactaccgagtagtcatcactcattggtctgat
ctcaatggaatgttctcacatgtaacaaattaccctctagactttgatgtctatcctcaa
gtctcaagtaaggtatctgcaatatataaagctacaggaacaaaacggttcaatgcaaac
actagaccagtaactcctggtaagcaatcctcagtcaagggaccatattataagaatccg
ggatgcacaacaagctgtggtttgaggctaccgaggaaaacggaatgcacagcagcaaga
ctgatcaaagatctcagctgtaaattcgttatgggcttacgtctggtggtgatgaggaag
aagaagaagaagagatctccaccattgaagaaggcttcttcttctgggatatctcagcct
tcagtcatctctgtcgttaatgataataatcacagatcagcggcaatagaagactgcata
caattcataaactcctcttcctccttcacaagatcaaattctacctgtggcagtaaatct
taa

DBGET integrated database retrieval system